KEGG   Drosophila sechellia: Dsec_GM20078Help
Entry
Dsec_GM20078      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM20078-PA
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:dse01009]
    Dsec_GM20078
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:dse03019]
    Dsec_GM20078
   04131 Membrane trafficking [BR:dse04131]
    Dsec_GM20078
   03036 Chromosome and associated proteins [BR:dse03036]
    Dsec_GM20078
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsec_GM20078
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsec_GM20078
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dsec_GM20078
Membrane trafficking [BR:dse04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dsec_GM20078
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dsec_GM20078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-C3HC4_3
Motif
Other DBs
NCBI-GeneID: 6620365
NCBI-ProteinID: XP_002044573
FlyBase: FBgn0174961
UniProt: B4ILG3
AA seq 619 aa AA seqDB search
MRARLQVLRAENQAIGAVGERCAMPYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGL
LTQMKQLSARAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCA
VLAAGSVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGL
ERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFN
VNIPWNKKGMGDLEYALAFQQLVMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYG
MLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVA
FQSCVESLQLCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATV
AASGPAVDRPDCGDERPSGSKPKVKVKTLSDYLADNKEALEQSEMFAVYPLKTCPHLRLL
RPEEAPRSLDSRAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTAD
LSVWCYACSAYVDHPRLYAYLNPLHVDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDEN
NDDDNVAGSSICLRLERNN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctcgtctgcaggtgctgcgagcggagaaccaagctattggtgccgtcggtgaa
aggtgtgctatgccctacgatgcccaaatgcttctgcactgcaatctaaacgatacgggg
catccggagcagccgtcgcgcatccagcacatccacaagatgcacgacgactacggtctc
ctgacgcagatgaagcaactgtccgccagggcggccaccacagacgaggtgtgcctggca
cacactcgcgcccatgtgaatacagtgcgtcgattgcttggccgcgagccgaaggaactg
catgacgctgctgggatctacaactcggtgtacctgcatccgcgcaccttcgactgtgcc
gtcctggccgccgggtcagtgctgcaggcggtggacagtgtgttgcgtggcgagtcccgc
agcggcatctgcaacgtccgtccgccgggccatcatgccgagcaggatcatccgcacggc
ttctgcatcttcaataatgtggccattgcggcgcagtatgccatacgggacttcggtctg
gagcgtgtgctgatcgtggactgggacgtccatcacggcaatgggacgcagcacatcttc
gagtccaatcccaaggtgctctacatcagcttgcatcgctacgagcacggctccttcttc
cccaagggacccgatggcaacttcgatgtggtgggcaagggagccggcaggggcttcaat
gtgaacataccctggaacaagaagggcatgggtgacctggagtacgcactggccttccag
cagctggtcatgcccattgcgtacgagttcaatccgcaactggtgttggtatccgccgga
ttcgatgctgccatcggcgatcccttgggcggatgcaaggtgacgcccgagggctacggc
atgctcacccactggctgtcggctttggccagcggtcggataatcgtttgcctggaaggt
ggctacaatgtgaactccatttcgtacgcgatgaccatgtgcaccaagacgctgctgggt
gatcccgtgccgacgccccagctaggagccacggcgctgcagaagccaccaacggtggcc
ttccagagctgtgtggaatcgctgcagctgtgcctgcaggtgcagcgcaaccactggcgc
tcgctggagttcgtcggacggcggctgccgcgcgatcccgtcgtgggcgagaacaacaac
gaggattttcttaccgcctccttgcgacacttgaatatctcaaatgacgatgctacggtt
gcggcaagcggacccgccgtcgatcgtcccgactgcggcgatgagcggcccagcgggagc
aagcccaaagtcaaggtaaaaacgctcagcgactacttggcggataacaaggaggccctc
gaacagagtgagatgttcgccgtgtatccgctcaagacgtgtccgcacttgaggctcctg
cgtccggaggaggcgccccgatcactagacagcagagcggagtgcagcgtttgcggatcg
acgggggagaactgggtgtgcctgagctgcaggcatgtagcctgcggtcgctatgtaaac
gcccacatggagcagcattcggtggaggagcagcatccgctggcgatgagcacggcggac
ctgtctgtgtggtgctacgcgtgctccgcgtacgtggaccatccccgcctgtatgcctac
ctcaatccgctgcacgtggacaagttccaggaaccgatggcctggacacatggctgtgcg
tggcgcgaggatggatgctatgcgacggggcccgatggtcgagatgaggatgatgagaat
aatgatgatgacaatgtcgccggtagcagcatctgcctgcgactggagcgcaacaactga

DBGET integrated database retrieval system