KEGG   Drosophila sechellia: Dsec_GM20252Help
Entry
Dsec_GM20252      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM20252-PA
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dse  Drosophila sechellia
Pathway
dse00062  Fatty acid elongation
dse00071  Fatty acid degradation
dse00280  Valine, leucine and isoleucine degradation
dse00310  Lysine degradation
dse00380  Tryptophan metabolism
dse00410  beta-Alanine metabolism
dse00640  Propanoate metabolism
dse00650  Butanoate metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
dse01212  Fatty acid metabolism
Module
dse_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dse_M00085  Fatty acid biosynthesis, elongation, mitochondria
dse_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dsec_GM20252
   00650 Butanoate metabolism
    Dsec_GM20252
  Lipid metabolism
   00062 Fatty acid elongation
    Dsec_GM20252
   00071 Fatty acid degradation
    Dsec_GM20252
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dsec_GM20252
   00310 Lysine degradation
    Dsec_GM20252
   00380 Tryptophan metabolism
    Dsec_GM20252
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsec_GM20252
Enzymes [BR:dse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dsec_GM20252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 6609058
NCBI-ProteinID: XP_002033761
FlyBase: FBgn0175135
UniProt: B4HQX7
AA seq 294 aa AA seqDB search
MANIAKIFASRAQGVLQAAARQPQVATRFSSSSTNNWEYIKTEVAGEGKNVAVITLNRPK
ALNALCNGLMKELSTALQQFGKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNF
LNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGT
QRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLI
VQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggccaacattgctaagatcttcgccagccgcgcccagggcgtcctgcaggcagctgcc
cgtcagccacaggtggccacccgtttcagcagctcctccaccaacaactgggagtacatc
aagaccgaagtggccggcgagggcaagaacgtggccgtgatcaccctgaaccgccccaag
gctctgaatgccctctgcaatggcctgatgaaggagctgtccaccgcgttgcagcaattc
ggcaaggataagaccatctccgccatcgttttgacgggcagtgagaaggccttcgccgct
ggggctgatatcaaggaaatggtgggcaacacctactcgcagtgcatccagggcaacttc
ctgaacgactggacggaggtggcccgcacccagaagcccatcattgctgccgtgaatggc
tacgccttgggcggtggctgtgagctggccatgatgtgcgacatcatctatgccggtgac
aaggccaagtttggtcagcctgagattgccttgggcaccattcccggagctggtggcacc
cagcgtctgacccgtgtcgttggcaagtccaaggccatggagatgtgcctcaccggcaac
atgatcggcgcccaggaggccgaaaagctgggtctggccagcaaggtggtgcccgccgac
cagttgctgggcgaggccgtcaagctgggcgagaagatcggcacccactccaatctgatc
gtgcagctgtgcaaggaggccgttaacaccgcttacgagaccactctccaggagggcctg
aagttcgagcgtcgcaccttccatgccacgttctccacggccgatcgcaaggagggcatg
accgccttcgccgagaagcgccctgccaagtttaccaacgagtaa

DBGET integrated database retrieval system