KEGG   Drosophila sechellia: Dsec_GM20735Help
Entry
Dsec_GM20735      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM20735-PA
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
dse  Drosophila sechellia
Pathway
dse00061  Fatty acid biosynthesis
dse00620  Pyruvate metabolism
dse00640  Propanoate metabolism
dse01100  Metabolic pathways
dse01212  Fatty acid metabolism
Module
dse_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dsec_GM20735
   00640 Propanoate metabolism
    Dsec_GM20735
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dsec_GM20735
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Dsec_GM20735
Enzymes [BR:dse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Dsec_GM20735
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Dsec_GM20735
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dsec_GM20735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp ATP-grasp_3 MetallophosN
Motif
Other DBs
NCBI-GeneID: 6608096
NCBI-ProteinID: XP_002032844
FlyBase: FBgn0175616
UniProt: B4HRH5
AA seq 2482 aa AA seqDB search
MLITILGTLAAFLAFLLTLIFGRGQKRSIPVQSSAATSATTATTGDSDNGNTNHNSSVIA
ATATATTTSSKPPIAPAAPPSAVKAGDKRFPKACIKKVQFSSESLRSDVEELCDQLKDSA
LSNLNNDNIRIACHQNNNNSSINKNQNNNSIDISISINKMSETNESNDTAAQTAEGERPS
FLVGDEIDERAAEAGEACDEFPQKMQSDVRQNGDISERRKRLRPSMSRGTGLGQDRHQDR
DFHIATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKL
PELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPTLPWSGSDLKAQYSGKKIKISS
ELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPALFRQVQAEVPG
SPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFED
MEKAAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPRLQVEHPCTEMVADVNLPAAQLQ
IGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPSGHVIAARITSENPDEGFKPSS
GTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELSI
RGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQ
ITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKE
IEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQTCVFEKENDPSLLRSPSAGKLI
NMIVEDGAHVSKGQAFAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDDP
SLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLSGYCLPEPFNAQRLRDIIEK
FMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASV
IDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRMKAAVHELLRQYYDVESQFQYG
HYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTLS
ELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLI
LSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLL
PTAHPNRLFSRMSSPDGLDQAAAESLGNSFVRTGAIAAFDSFEHFEMYSDEILDLLEDFV
SPAMVNAKVLEAVDAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVRE
TGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIY
RHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHS
DLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRTDCNHIFLNFVPTVIMDPAKIE
ESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQT
EPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMT
ERHWREFSKARPTVDIRTPDKILIECKELVLEGDNLVEMQRLPGENNCGMVAWRIVLATP
EYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQLKVPRIYISVNSGARIGLAEE
VKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGKD
DGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILT
GYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCD
LPIVLPSDRIERPVDFMPTKSPYDPRWMLGGRVNPVNANDWENGFFDRDSWSEIMASWAK
TVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQA
IKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELR
GGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKYKEKDLIKTIHRLDPTTIGLKK
ELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHFADLHDTPERMLEKECISEIVP
WRDSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAKQMLRRWLVEEKGATEAYLWDKN
EEMVSWYEEQINAESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGLTPVNR
GVVVRTLAQMQLNEETSNSNQG
NT seq 7449 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcacgatattaggcactctggctgcttttctcgcattcctcttgacattgatc
tttggccgcggccagaaaagatccatacccgtccaatcgtctgcagcaacatccgccacg
acagcaacaactggcgacagcgacaacggcaacaccaatcacaactccagcgtgattgca
gctacagcaacagcaacaaccaccagcagcaagcctcccattgctccagcagcacctcct
tcggcggttaaggcgggtgacaagcgattccccaaggcgtgcatcaagaaggtccagttc
tccagcgagagcctccggtccgacgtggaggagctgtgcgaccagctgaaggatagcgca
ctcagcaacctaaacaacgacaacatccgcatcgcctgccaccagaacaacaacaacagc
agcatcaacaagaaccagaacaacaacagcatcgacatcagcatcagcatcaacaagatg
agcgaaacaaatgagtccaatgacacggccgcccaaaccgccgagggtgagcgacccagc
tttttggtgggcgatgagatcgacgagcgggccgccgaggcgggcgaggcttgcgacgag
ttcccccagaagatgcagagcgatgtccgccagaatggggatatttccgagcggcgcaag
cggttaaggccgagtatgtcgcgtggcacagggctgggccaggaccggcaccaggatcgc
gacttccacatcgccaccaccgaggagttcgtgaagcgcttcggcggcacccgagtgatc
aacaaggtcctgattgccaacaacggtatcgcggccgtcaagtgcatgcgatccatccgg
agatgggcgtacgaaatgttcaagaacgagcgagccatcaggtttgtggtgatggtcact
ccggaggatctgaaggcgaatgccgaatacattaagatggcggatcactatgtgcccgtg
cccggcggatcgaacaacaacaactacgccaatgtcgagctcatcgtggacattgctctt
cgcacccaagtgcaggccgtgtgggctggttggggtcatgcctccgagaacccgaagctg
cctgagctgctccacaaagagggtctggtgttccttggccctccggaacgtgccatgtgg
gcgcttggcgacaaggtggcctcctcgattgtggcccaaactgccgaaattcccaccctg
ccgtggtccggatcggacctgaaggcccagtacagtggcaagaagatcaaaatttccagt
gagctcttcgcccgcggctgtgtgaccaatgtggaacagggtctggctgcagttaacaag
attggcttccccgtaatgatcaaggcctcggaaggaggtggtggcaagggtattcgccgc
gtggacaccactgaggagttccccgccctgttccgccaggtgcaagctgaggtgcccggc
tcaccaattttcgtgatgaagctggcacgcggagcccgccacttggaggtgcaactgctg
gcggatcagtacggcaatgccattagcttgttcggccgtgactgctccatccagcgtcgt
catcagaaaattattgaggaagctcctgccatcgtggcccagccagaggtgttcgaggac
atggagaaggccgccgtgcggctcgccaagatggtgggttacgtcagcgcgggaactgtg
gagtatctatatgatccggagggtcgctacttcttcctggagctgaacccccgtctgcag
gtggagcatccgtgtacggagatggtggccgatgtgaatcttcccgctgctcagctgcag
attggaatgggaattcccctttaccggctcaaggacatccgtctgttgtacggagagtct
ccgtggggctcctcagtcattgacttcgaaaatccaccgaacaaaccgcgtccctccgga
catgttatcgctgctcgtatcacctcggagaaccccgacgagggctttaagcccagttct
ggaaccgttcaggagcttaacttccggtcgagcaaaaatgtgtggggctacttcagtgtg
gctgccagtggaggattgcacgagttcgcggactcacagtttgggcattgtttctcctgg
ggcgagaatcgtcagcaggctcgagagaacctggtgattgccctgaaggagctgtccatt
cgaggtgatttccgaacgacggtggagtacctgatcactctgctggaaacgaatcggttc
ctcgacaacagcatcgacaccgcctggctagatgccttgatcgcagagcgtgtgcaatcc
gagaagcctgatatcctgttgggcgtaatgtgcggatcgctgcatatcgcagatcgtcaa
atcactgagagcttctccagcttccagacctctctggagaaaggtcagatccaagcagcg
aacacgctaacgaacgtggtggatgtggagctaatcaacgatggcatccgttacaaggtg
caggccgccaagagcggagccaactcgtacttcctgctgatgaacagctcgttcaaggag
atcgaggtgcaccgcctctccgacggaggtttgctcatctctttggagggcgcctcctac
accacgtacatgaaggaagaggtggatcgctaccgcattgtgattggcaaccagacatgt
gtcttcgaaaaggagaacgatccatcgctgctgcgcagtccgtctgcgggaaagctcatc
aacatgattgtggaagatggcgcacatgtaagcaagggccaggcctttgctgagattgag
gtgatgaagatggtgatgaccctgacgtcccaggaggcaggcacagtaacgtttgtgcgt
cgaccaggagctgttctggatgcaggatcccttttgggccacttggagctggacgatcca
tcgctggtgacgaaagcacagcccttcaagggtcagttcctgcagccagagaatgcaccg
gtgccggagaaactaaacagggtgcacaatacttacaagagcatccttgaaaacacactg
tctggttactgcctgccggaacctttcaatgcgcagagactgagggacattatcgagaaa
tttatgcaaagcttgcgggatccctcgttgccgctgttggagctgcaagaagttatcgcc
tccatctcaggccgcatacccatatccgtggagaagaagatccggaaactgatgacgctg
tacgagcgaaacataactagtgtgctggcccaattcccctcgcagcagatcgccagtgtt
attgacagccatgcggccacgctgcagaagcgcgctgaccgagatgtcttcttcctgacc
acccagagcattgtgcagctggtgcagcggtataggaacggaatccgcggcaggatgaag
gccgccgttcatgagctactgcgtcagtactacgatgtagagtcgcagttccagtatgga
cactacgacaaatgcgtgggactggtgcgagagcacaacaaggacgacatgcagacggtg
gtcaacaccatcttctcgcactctcaggtggccaaaaagaatctgctggtcactctgctc
attgatcacctgtgggccaacgaacctggactaacggacgaattggccaacacgctgagt
gaattgacctccttgaatcgagctgagcactctagggttgctctgcgctcccgccaagtt
cttatcgctgcccaccagccggcctatgagctgcgccacaaccaaatggagtcgatcttc
ctctccgccgttgacatgtacggtcatgacttccaccccgagaacctgcagcgcctgatt
ctgtcggagacctcaatctttgacattctgcacgacttcttctaccactctaaccgggca
gtgtgcaatgctgctctggaagtctatgtgaggagagcttacacatcctatgagctgacc
tgcttgcagcatttggaactctccggtggcctgccgctggtgcatttccagttcctcctc
cccacagctcacccgaacaggctgttctcgcgcatgtcctcccccgatggattggatcag
gcagcggcagagtccttgggaaactcattcgtgcgcaccggagcgatagcagcctttgac
tccttcgaacactttgagatgtactcggacgagattctggatctgctcgaagacttcgtc
tcgccagccatggttaatgccaaggtcctggaagccgtagatgcagcggattccatctcg
gacagccgacacagcacctcgatcaatgtgtccttgtcggatcccgtaacccgggcgaat
gctgccgaggaggccaagtccaccgaaccgattcacattgttagtgtggctgtgagagaa
acgggcgagctggatgacctgcaaatggcccagatctttggaaattattgccaagagcat
aacgaggagctcttccagcgacgcattcgtaggattacatttgctgctctgaagaagcgt
caattccccaagttcttcacgttcagagccagggataagttcacggaggatcgtatttac
cggcatctggagccagcatctgctttccatctggagctgaaccgcatgaagacgtacgat
ctggaggctctgcccacggctaaccagaagatgcacctgtaccttggcaaggccaaggtg
tcgaaaggtcaagaggtcacggactaccgcttcttcattcgctcgatcatccgtcattca
gatctgattaccaaggaagcctctttcgagtatctgcaaaacgaaggagagcgcgtgctc
ctggaggccatggatgagctggaggtggcattctcgcatccgcacgccaagcgcaccgac
tgcaaccacatcttcctgaactttgtgcccaccgtcatcatggatccggctaagatcgag
gagtctgtgacaaagatgattatgcgatatggtccgcgtctgtggaagctgcgtgtactg
caggctgagctcaagatggtcatccgccagtcaccacagtcacccactcaggcagtgcgt
ctgtgcattgcaaatgactccggctacttcctggatatttcgatgtacaccgagcaaaca
gaaccagagacaggaatcattaagttcaaggcctacggtgagaagcagggatctctgcac
ggacatcccatttccacgccctacatgaccaaggacttcctgcagcagaaacgtttccag
gcgcagtccaacggtaccacctatgtctatgatgtgcccgacatgttccgccagatgacc
gagcgtcactggagagaattctccaaggctcgtcccaccgtggacattcgcactccggac
aagattttgatcgagtgcaaggagctggtcctcgagggcgacaaccttgtagagatgcag
cgtctgcccggcgagaacaattgcggcatggtggcttggcgcattgtcttggctactccc
gaatatccgaatggccgtgagatcattgttatagccaacgatctcacctacttgattggt
tcctttggaattaaggaggacgttctgtttgccaaggcttcccaattggctcgccaactc
aaagtaccgaggatatacatctccgtgaacagcggtgcccgcatcggacttgctgaggag
gttaaagctatgttcaagatcgcatgggaggatccagaagagccagataagggtttcaag
tacctttacttgagcaccgaggactatgctcaggtggccaacctgaactcggtgagggct
atcctgatcgaggacgagggcgagcagcgttacaagattaccgacatcatcggcaaggac
gatggcctgggcgtggagaacctgcgctacgctggcttgattgccggtgaaacgtcgcag
gcctacgaggagattgttaccatcgctatggttacctgccgcaccattggcattggatcc
tatgtggtgcgcctgggtcagcgcgttatccagatcgataattcgcacattatactcact
ggctatgctgcgctcaacaagctgcttggacgcaaggtgtatgcctctaataatcagttg
ggtggcacacagatcatgtttaacaacggagtcacccacaaaacagaggccatcgacttg
gacggtgtctacaccatcctcgactggctctcgtacatccccgcatacatcggttgtgac
ctgcccatcgttttgcccagcgatcgcatcgaacgccctgtggacttcatgcccaccaag
tcgccctacgatccgcgctggatgctaggcggccgtgtgaatcctgtgaacgcgaatgac
tgggagaatggattctttgatcgggactcgtggagcgaaatcatggcctcgtgggccaag
acggtggtcactggtcgcgcccgtctaggcggtgtccccgtgggtgtaatagccgttgag
acccgcaccgtagaagtggagatgcccgccgatcctgccaatctcgattcggaagccaag
accctgcagcaggcaggtcaggtgtggtaccccgactcatcgtacaaaacggcacaagca
atcaaagattttggacgagaggagttgccgcttattgttttcgcaaattggcgaggcttc
tccggcggcatgaaggacatgtacgagcaaatcgtcaagttcggagcatacattgtcgac
ggcctgcgggagtacaagaagcctgtgctcatctatctgccgcccaacgccgagctgcga
ggtggagcctgggccgtgctggattccctcattaacccgcgctacatggaaacgtatgcc
gatccggaggccagaggaggtgttctcgagccggagggcattgtggaaataaagtacaaa
gagaaggatctgatcaagacgattcaccgcttggatccgaccaccattgggctgaaaaag
gagctcgatgaggcaaatgcgtctggcgacaaggtcagggctgctcaggtggacgaaaag
atcaaggcccgcatcgctgtgcttatgcacgtctaccacacggtagcagttcactttgcc
gacctgcacgacacgccagagcgaatgctagagaaggagtgtatcagtgagattgtgcct
tggcgcgattcccgccgctggctgtactggcgtctgcgacgtctcctgttggaggacgcg
tatattaagaagatcctgcgcgctcaggacaatctctccgtgggtcaggccaagcagatg
ctgcgtcgctggctggtagaggagaagggtgccacagaggcttatctgtgggacaaaaac
gaggaaatggtgtcttggtatgaggagcagatcaatgccgaatctattgtttctcgcaac
gttaactccgtgagacgggatgccattatttctaccatttcgaaaatgctcgaggactgt
cccgacgtagcgctggacgctgtagtgggtctttgccaaggtctgacgcccgtgaatcgt
ggcgtcgtcgtacgcacactagcccagatgcagctgaatgaggagacctctaacagcaac
cagggatga

DBGET integrated database retrieval system