KEGG   Drosophila sechellia: Dsec_GM21934Help
Entry
Dsec_GM21934      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM21934-PA
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dse01002]
    Dsec_GM21934
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dse04147]
    Dsec_GM21934
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dsec_GM21934
Peptidases [BR:dse01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dsec_GM21934
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dsec_GM21934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Lipase_3
Motif
Other DBs
NCBI-GeneID: 6609896
NCBI-ProteinID: XP_002034546
FlyBase: FBgn0176811
UniProt: B4HPC1
AA seq 411 aa AA seqDB search
MYELHNCLRSVFLATLIPGTILLSWLTGLVGLRSLQACLLIFFLIFVVLPLIFRYSVTFQ
RGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRR
FKRELRVEEEVAQDPDQQLDPAPGNEHELKELSPAIRSEFPVVLPENEQLFYERLLRMPG
GTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMM
VFEYIANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYR
IALDGRSRSSGPVEFHRFGASRKYGHKYLCRAPELPGLIQKFVENYRDAVY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagcttcataattgcctaaggtccgttttcttagccacactcattcccggaacg
atcctacttagttggctaactggtctggtgggtctgcgatctctgcaagcttgtctgctg
atcttcttcctgattttcgtggtcctgcctttgatatttcggtactctgtaacgttccag
cgtggcatcctatttctgacatttattaagtatcccaaaggactcgatctcaccaagccg
gaaagcgtgggtctgtatgccacacggaacttctacataaccgtaaaggatcacgatcag
gacgaggatggagtgcgagttggtgtgtggcacgtcctgcccagcaatgcagtgcgtcgt
tttaagcgtgagctgcgcgtggaggaggaagtggcccaggacccggatcagcagctggat
cctgcccctggcaacgaacacgagctgaaggagctatcgccagccatacggtctgaattt
cccgtcgtgctgccggaaaacgagcagctcttctatgagcgattgctgcggatgcctggc
gggactgtggtcctctatctccacggaaacacagctagccgaggcagtggtcaccgatcg
gaggtgtataagctactgcggaagctcaactaccatgtgttctccttcgactacagaggc
tatgccgactccgatcccgtgcctccgacggaggaaggcgttgtgcgcgatgccatgatg
gtttttgaatacatagccaacaccacttccaatccgattgtggtgtggggccattccctt
ggcaccggagtggccacgcatctttgcgccaagctagccagcctacgggaaagggctccc
aggggagtgatcctcgaaagcccgttcaccaacattcgggacgagatacgcatgcatccg
tttgccaagctgtataagaatctgccctggttcaattttaccatctcgcaaccaatgtac
accaataggctgagatttgagtcggatgttcatgttttggagttccggcaacccatcatg
atcatccatgctgaggacgatgtcgttgtgccgtttaatctgggctatcgtctgtatagg
atcgcattggatggaagaagtcgatcctcgggacccgtggagttccatcgctttggggcg
agccgaaagtatggacacaaatacctctgccgagcaccggaattgccgggactgatccaa
aagtttgtggagaactaccgtgacgccgtatactag

DBGET integrated database retrieval system