KEGG   Drosophila sechellia: Dsec_GM22129Help
Entry
Dsec_GM22129      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM22129-PA
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dse01001]
    Dsec_GM22129
   01009 Protein phosphatases and associated proteins [BR:dse01009]
    Dsec_GM22129
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsec_GM22129
Protein kinases [BR:dse01001]
 Serine/threonine kinases: Other
  Wnk family
   Dsec_GM22129
Protein phosphatases and associated proteins [BR:dse01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsec_GM22129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase OSR1_C Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 6616468
NCBI-ProteinID: XP_002040829
FlyBase: FBgn0177000
UniProt: B4IAR9
AA seq 1916 aa AA seqDB search
MVLPPAPRNLKGQNTSISSEEQTVQGANIQKSGLRSFNRSASSRQKPNPTSKLKDTLNRK
STCKQGTLSAHTSTSSTTSIQSSPIEPTSSLPTLNTTPTPPTASKSNLFVRVLRRFSSNS
LPGKTASNPKNADDVPKVNDNNNGDLGKQQSTDVEVLCSQDNQSREQNEDEMDSKIEPAD
AISNQKAGLTSGKPKKDKSVKGTSQAVVSDTKKMEARKSSSDTVIEPLIKQQAPLHSSKT
TPTTLTANFVQNIRFVRKNVEQSGRNTNPLQFVELETEFPRDYDDNIEMLSREAEHLEEQ
FRTPTRSNATDATSHHVAGIIDNIITEASRSLTIEKTEDDVPLKSSTKHSSGVKRVGFQV
EEKDDTEVQSEKQAKSIDDITKKAESSEASAEEAAVTGSSTDASASLLPSTSLVSTTSSA
TSISKSKSDEDDDPVAMSPCGRFFKYDKEVGRGSFKTVYRGLDTLTGVPVAWCELLDKQV
KKSERTRFREEADMLKKLQHPNIVRFYTYWEFPIGRKKNIVLVTELMLSGTLKSVKIGDL
GLATLKNRSHAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMAISEYPYSECKGPA
QIYKKVISGIKPAALAKVEDPNVRDIIERCIELKKEDRPSCNELLESEFFDEDIGIRVEP
TASEQFLSDPSISIIEFRLRFMDPKKRSSRHKENEAIQFEYNIKHDEYEQIAQEMMKENI
ISEDDSRAVARLLKVQVVSLLKERAQRQTQIKLQNEKSRLEKLALQKQRESLPTNVDEDE
EEEEESEDEEDGVKWNQRLQLRYDLLNTDSETSLALSTNSVEPQQLSTRSNTSIPNSGIQ
QPVQVPGQVPVSQLISVQPQAIPSPAIPMQQKPTVHYIQPPQLASYQNSNASMQEMTNNQ
VISPTGSQQMQQQQPVVAPTVNHQVMPQQQVNQQQQPQMMQQIPQQVQVQQVGAQQQPQT
VLPPQPHEQQPQQQQQPLQQQLQQLMHTNVQAPDLTQQQQIAQQQAQQYFQQQQPQQAVN
MQQAYAMQQAGQQQQLSQPLQIQQQILQQQQAAVSHQQQIMQQQLAQHQLQQLQQQQLQQ
QQLQQQHQQQIQQQQLQQQQLQQQQFVQQYAQAMPQQQHQQLVTGSQVMAPHQQPIQIPV
QMQVPPTSVAPPVQQTYNQQGGQVALSDPQQQQHPGLSAVPPQPTQFIQQPTQQPIQLSM
PLEQQLQQLLHSQPAQQQQPMSQQQQQPMVQQQQQPLVQQQQLPLVQQQPPLVQQQQPLV
QQQQPLVQHQQPLVQHQQPLVQQPQQQQPHAQTQQPQPQTQHPHVVQQQPQQHQPAVEQI
SQISSQVPVQQENLQPIQVNKDANVATDAMSLNSAHGALETAPKTEPQNSGDAEKQQKQT
GTGTRSQKPRRSNRSGNERIPKLSVTSVDEGSVINCHMENKLKTITFKFDIGDRDETASD
ITKMFEPTIHGVETLPSGGGGAEQSNCNLTLEARSHVSNIPNAKEPQLNVSTPPTTTSTM
SSSSTASRDAPNSSNDVTIGSGSVSRKTSTASEYTSLSIDYMPDSNITPTGPEPPLDDGK
DKKTCSLAIARMQKLLESAGNGAPRSLNLPLNRHLKIQEDLKHTRSLDDLTTVKITFDMP
NKAAVGTSENAQQATEAEAEKPKDKSAQAVGNQGVGAANTLEQLKIELENITHAHAFASA
VVASINNRAPHQASPAMSSLKATSGQPQTQEITKPNNGAGPSAPSVGQNTPTAALTSARG
SGSFRLQLTSYIHRHSVGSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRRACFFS
SYASASATERYSIPISTNVPANAAYYSAAAAQLPTNLAAPAAPSSSNPTSTSSANT
NT seq 5751 nt NT seq  +upstreamnt  +downstreamnt
atggtactacctcctgcaccacgcaacctcaaaggtcagaatacctcaatttctagcgag
gagcaaactgtgcagggagctaatatacaaaagtcgggactccgttcgtttaatagatct
gcctcctctaggcaaaagccgaacccgacatcaaaactaaaagacacactaaacagaaag
tccacttgcaagcagggcacactttctgcacacacaagcactagcagcaccacttcaatc
cagtcatcacccatcgagccaacttcttctctacccacgctgaacaccacgcctacacca
cctactgccagcaaaagtaacctatttgtgcgggtgctacgacgattttcaagtaactcc
cttcccggcaagacggcgtcaaacccgaaaaacgcggacgacgtaccgaaagtcaacgat
aacaacaacggcgatctgggcaaacagcaatcaaccgatgtagaggtgctttgctctcag
gacaaccagagcagggaacagaatgaggacgaaatggatagcaaaatagagcctgcagat
gccataagcaaccagaaagctggtcttacttcgggcaaacctaaaaaagacaagtcagtc
aaggggacgtcgcaagcggttgtttcagacaccaagaaaatggaggccaggaagtcctcc
tcggacacggtgattgagccattgatcaagcagcaggcgccactgcactcgtcaaagacc
acgccaacgactttgacggcgaacttcgtgcaaaacattcgattcgtccgtaaaaatgtg
gaacagtcaggcaggaacaccaatccactgcagttcgttgaactcgagacggagtttcct
cgtgactatgacgacaacatcgagatgctttcccgcgaggcggagcatctggaggagcag
ttccgcacgcctacgcgctccaatgctacggatgccacttcccaccatgtggccggaatc
atcgacaacataataaccgaagcgtcacggagtcttacaatcgaaaagactgaagacgat
gtgccattgaagtcttctaccaagcactcgagcggcgtaaaacgagttggctttcaagta
gaggaaaaggacgataccgaggttcagagcgaaaaacaggcaaagagcatcgatgacata
accaaaaaagcggagagttccgaggctagcgcagaggaagctgctgtcaccgggtcctcg
acagatgcatctgcatctcttctgccctccacgtcgctggtctccaccacatcttcagct
acatcgatatccaagagtaagagcgatgaggacgatgatccggtggccatgtcgccgtgc
ggacgattctttaagtacgataaggaagtcggacgcggttcctttaaaactgtctatcgt
ggcctggacacgttgacgggtgttccagttgcctggtgcgagttattggacaagcaagta
aaaaaaagtgaacgtactagatttcgcgaggaggcagacatgctgaagaaacttcagcac
ccaaacatagtgcggttttatacatattgggagtttcctattggccgcaagaagaatatt
gtactagtcaccgaactaatgttatctggaactttgaaatctgttaaaatcggcgacttg
ggcctggcaactttgaaaaaccgctcccacgcaaaatctgtgattggtacgccggagttc
atggccccggaaatgtacgaggagcactacgacgagtcggtggacgtatatgcattcggc
atgtgcatgttggagatggccatttccgaatatccttacagtgagtgcaagggtccagcc
cagatctacaaaaaggtgatatcgggcattaagccagcggcgctggctaaggtggaggac
cccaacgtgcgcgacatcatcgaacggtgcattgaactaaagaaggaggatcggcccagc
tgcaatgaactgctagaatcggagttctttgacgaagatatcggtatacgagttgagcca
actgcttcggaacagttcctttctgatccgagcatcagcatcatcgagttcagactgcgg
tttatggatcccaagaagcgctcgtcccgtcataaggaaaacgaggcaattcagtttgag
tacaacatcaagcatgacgagtacgaacagattgcgcaagaaatgatgaaggaaaatatt
atatctgaggacgactctcgcgctgtagctcggcttttaaaagtgcaggtggtgtcgttg
cttaaagaacgtgcccagcgtcaaactcaaatcaagctgcaaaacgagaagtctcgtttg
gaaaaattggcattgcaaaagcaacgtgagagtttgccgaccaacgtcgatgaagatgag
gaagaggaggaggagtctgaggacgaggaggatggtgttaaatggaatcagcgcctgcag
ctaagatatgacctgcttaacactgattcagaaacaagccttgctctatccacgaacagc
gtcgaaccgcagcagctgtccactcgctcgaacacttcgattccgaacagtggcattcag
caacctgttcaggtcccaggtcaagtgcctgtttcccagttgatctcggtgcagccacag
gctattccgtcaccggctattcccatgcaacagaagccgacggtgcactacattcaaccg
ccacagctggcctcttatcaaaattcgaatgcatcgatgcaggagatgaccaataaccag
gtcatatcgccgacaggcagtcaacaaatgcaacagcaacaacccgtagtggcaccaaca
gtcaatcatcaggtcatgccgcagcagcaagtcaaccaacagcagcaaccacaaatgatg
cagcagataccccagcaagttcaagtgcagcaagttggtgcgcaacagcagccccaaact
gttttgcctccgcagccacatgagcagcagccacagcaacaacaacagccactgcagcag
caacttcagcagcttatgcacactaacgtgcaggctccggatttgactcaacagcaacaa
attgctcagcaacaggcccagcaatattttcagcagcaacagcctcagcaggccgtaaac
atgcaacaagcttatgcaatgcagcaagctggccagcagcaacagctttcgcagcctctt
caaattcagcaacagatcttgcagcaacaacaagcagccgtctcacatcagcaacagatt
atgcagcagcaactggcccagcatcagctgcaacagcttcagcagcagcagcttcaacaa
cagcaactgcaacagcagcaccaacagcaaatacaacaacagcaactccaacaacaacaa
ctccagcaacagcaattcgtacagcagtatgcgcaggcaatgccgcagcaacaacatcag
cagctcgttacgggatcgcaagtcatggcaccgcatcagcaacctattcagatcccagtg
cagatgcaagttccgccgacttccgtggcacccccagtacagcagacttacaatcagcag
ggcggacaagtagcgctcagtgatccacaacagcaacagcatcccggattatcggccgta
ccaccacagccaacgcaatttatacaacagcccacgcagcaacccatacaactgtcaatg
cctttggagcaacaattgcagcaattgctgcatagccagccagcccagcaacaacagccc
atgagccagcagcagcaacagcctatggtccaacagcagcaacagcccttggtgcaacag
caacaactgcctttggtgcaacagcagcctcctttggtccaacagcagcagcctttggtc
cagcagcagcaaccgctggttcagcatcagcagcctttggtccagcatcagcagcctttg
gtacaacagccccaacaacagcaaccacatgcccagacacagcaaccacagccccagaca
cagcatccacacgtggttcagcaacaaccgcaacagcatcaacctgcagtagagcaaatc
tcacagatttcttcgcaagtgcctgtgcaacaggaaaatctgcagccaatacaggtcaac
aaagatgcgaatgtagcaacggatgcaatgtctctaaatagcgcccacggagccctcgaa
actgcaccgaagacagaaccccagaactctggtgatgcggaaaagcagcaaaagcagaca
ggcacgggcacacgttcccagaaaccgaggcgttccaaccggagcggcaacgaaaggatt
cccaagcttagtgtaaccagcgttgacgagggcagcgtcataaactgccacatggaaaat
aaacttaaaacgattacatttaaattcgacataggagaccgggatgaaaccgccagcgac
atcacaaagatgtttgagcccactatccatggcgttgaaaccctgccatccggtggcgga
ggcgctgaacagtcgaactgcaacttgactttagaggccaggtcccatgtatccaacata
ccaaatgcgaaggaaccacagctgaacgtcagcactccgcccacaaccacttcgaccatg
tcttcctcatcaaccgcatcgagggatgcgcccaatagcagcaatgacgtgaccatcggt
tctggttccgtttctcgaaaaacaagcacggcctcggagtacacttcgctatcgattgac
tatatgcccgacagcaacattactccaactggtccagagccaccgcttgacgatggcaag
gataagaaaacttgctcccttgccatagccagaatgcaaaagctcttggagtcggccggc
aatggtgctcctcgcagcctgaatttgcccttgaatcgtcacctgaagattcaagaggac
ttgaagcatactagaagtcttgacgatttgaccacagtgaaaataacctttgacatgccc
aacaaggccgcagtgggtacttcggaaaacgctcagcaggccacagaagcggaagcggag
aagccaaaagataaatctgcacaggcagtaggcaaccagggagttggagcggccaacact
ctagagcagttaaaaatagaactggaaaacatcactcatgcccacgcgttcgcctccgct
gtagtggcctcgattaacaacagagctcctcatcaagcttccccagcaatgtcctcccta
aaggcgacttctggacaaccacagacacaagagataaccaagccaaataacggagcaggc
ccttcagcaccctcagtaggtcagaatactcccactgcagccttaacatccgccaggggc
tcaggctccttccgtctacaactcacgtcgtacatccatcgacacagcgtgggatccgtg
gnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnttaccgaagagcctgtttctttagc
agctacgcatccgcatctgctaccgagcgatattcaatccctattagcacaaacgttcca
gctaatgcagcttactattctgcggctgccgcacagcttccaaccaatttggcagctcca
gcagctccgtcctcatcgaatccgacgtccacaagctccgcaaacacataa

DBGET integrated database retrieval system