KEGG   Drosophila sechellia: Dsec_GM22394Help
Entry
Dsec_GM22394      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM22394-PA
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00052  Galactose metabolism
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM22394
   00052 Galactose metabolism
    Dsec_GM22394
Enzymes [BR:dse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dsec_GM22394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 6616485
NCBI-ProteinID: XP_002040846
FlyBase: FBgn0177264
UniProt: B4IAT6
AA seq 367 aa AA seqDB search
MVRVIEDMFGIAVNPMTQKTDRVRRFTLVTERGMSVSILTMGAIIQSLKVPDFNGKLEDV
CLGYDDVAGYYRNQQYFFGATIGRMANRTAHGRFKLCGKEVSVSRNLRDRHHQNGGFVGF
DSVIWDVVGVHKDGVTLQHISPDGHEGYPGELTTNINFSLNETGCFGMRIEARTKATTAV
NISNHSFFNLAGHGAGRDSLYQHMLMIKAQKIVDVDQELLPTGKLMRVRTTPYDFSSLVS
LGKRLNQVSTCPLGGFDNHFCVDIPPNRVQLVARVVHPCSGRFMEVHTNQPGLQFSTANH
LPSEDSSDIPISGKDGSNYVRQGAFTLQTQKYPDAMNHCDFPSVVLNPGQLYDHQVVYRF
GSCPKRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgagtgatcgaagacatgttcggcatcgccgtcaacccgatgacgcagaagacc
gaccgtgtccggcgcttcactcttgtcacagagcgcggcatgtcggtgtcgattctgacg
atgggtgccatcatacagtccttgaaggtgcccgacttcaacggcaagctggaggacgtg
tgcctgggctacgacgacgtggcagggtactaccgtaaccagcaatacttctttggagcc
accattggccggatggccaatcgtacagcacacgggcgcttcaagctctgcggcaaggag
gtcagtgtgagtcgaaacttgcgggataggcatcaccagaacggcgggttcgtgggcttc
gacagcgtcatatgggacgtggtgggggtgcacaaggacggtgtcaccctgcagcacatc
tcgccagacgggcacgagggctatccgggcgagctgaccaccaacatcaacttctcactc
aacgagacgggctgcttcgggatgcgtatcgaggcgcggacgaaggccaccacggcggtg
aacatctcgaaccacagcttcttcaatttggccggacacggcgcgggtcgggactcgctc
tatcaacacatgctgatgatcaaggcccagaagatagtggacgtagaccaggagctcctg
cccaccgggaagcttatgcgcgtgcgcaccaccccgtacgacttctccagcctggtcagt
ctgggcaagcggctgaatcaggtgtccacctgcccgctgggcggttttgacaaccatttc
tgcgtggacattcctcccaaccgggtgcaattggtcgcccgcgtggttcacccatgcagt
ggacggttcatggaggtgcacaccaaccagccgggcctccagttcagcacggcaaaccat
ctgccgagcgaggacagctcggacatccccatctcgggcaaggatgggtccaactatgtc
cgccagggagccttcactctgcagacgcagaagtacccggacgccatgaaccactgtgac
tttccctcagtcgtgctcaatcccggccagctttacgatcaccaggtggtctaccgtttt
ggctcctgtcccaagcgagtgtag

DBGET integrated database retrieval system