KEGG   Drosophila sechellia: Dsec_GM23455Help
Entry
Dsec_GM23455      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM23455-PA
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsec_GM23455
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     Dsec_GM23455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DUF1256
Motif
Other DBs
NCBI-GeneID: 6607817
NCBI-ProteinID: XP_002032575
FlyBase: FBgn0178322
UniProt: B4HHL9
AA seq 343 aa AA seqDB search
MKRLTERVHHEEQESEEVVWVKREDARSAGKLPIVFSRNYAVRFGGLERLHPFDAAKGKH
IHKLLCAQLQLDDGSFYEPTELTKDQLRRIHTRDYLKSLRWSMNVACIAEVPVMAFVPNR
YIQRSYLRPMRFQAAGSILAGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVR
LFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYILDMYNAFVYPRDHVAKESIRCAV
ELRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAISAEGVIERDR
LVFSTFRALGIPVVMLLSGGYLKASAGVITDSIVNLRLQGLLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctgactgagcgagtgcaccacgaggagcaggagtccgaggaggtggtttgg
gtcaagcgggaggatgcacgctccgccggcaagctgcccatcgtgttctcgaggaactat
gcggtgcgctttggtggccttgaacgcctacatcccttcgatgcggccaagggcaagcac
attcacaagctcctgtgcgcccagctgcagctcgacgacggcagcttttacgagcccacg
gagctgaccaaggaccagctgcgtcgtattcacacaagggattacctaaagtcactgcgc
tggagcatgaatgtggcctgcatcgctgaagtgccggtgatggccttcgtcccgaatcgc
tacattcagcggtcctatttgcgtcccatgcgcttccaagcagccggttccattttggcc
ggtaagctggcgttggattatggttgggccatcaacctgggcggtgggttccatcactgt
tgctcgtacagaggcggtggtttctgtccgtatgctgacatctctctgctcatcgtgagg
ctgtttgagcaggaaccattccgggtgcgccgcataatgattgtggacctggatgcccat
cagggcaatggacacgagcgggacttcaacaacgtggcagccgtctacattttggacatg
tacaatgcctttgtctatccgcgggatcatgtggccaaggagagcatccggtgtgcagta
gagctgcgcaactacacggaggatggattctacctgcggcaacttaaacgctgcctgatg
cagtccctggccgagttccgtccagatatggtcgtctacaatgcgggaacggatgtgctc
gagggcgatccattgggcaatctggctatttctgcggagggcgtcattgagcgggatcgg
ctggtgtttagtacatttcgcgcattaggaattccggtggtgatgctgctgagtggtggc
tacttgaaggcatccgcaggggtaattacggattccattgttaatcttcggcttcaggga
ttgctaaagtaa

DBGET integrated database retrieval system