KEGG   Drosophila sechellia: Dsec_GM23509Help
Entry
Dsec_GM23509      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM23509-PA
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Pathway
dse04013  MAPK signaling pathway - fly
dse04068  FoxO signaling pathway
dse04624  Toll and Imd signaling pathway
dse04933  AGE-RAGE signaling pathway in diabetic complications
Module
dse_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM23509
   04068 FoxO signaling pathway
    Dsec_GM23509
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dsec_GM23509
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsec_GM23509
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsec_GM23509
Protein kinases [BR:dse01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dsec_GM23509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase FTA2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 6607690
NCBI-ProteinID: XP_002032454
FlyBase: FBgn0178376
UniProt: B4HGI7
AA seq 347 aa AA seqDB search
MSKFVKVAINERLWEFPDIYEFVCFLGGGSFGQVAKVRLRGTENYVAMKRLMHPFEREED
AKGAYREIRLLKHMNHRNVISLLNVFHPPGHNMMDFKQVYLVTHLMDADLHRYSRSKRMS
DNEIRIILYQILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADNMTDYV
GTLWYRAPEIIFLRGQYTKAIDVWSVGCILAELITGRVLFPGENYPSQIRCLIDIIGTPT
REFITGISMEKSRSFLERYPLRQRCDFHHLFMGTDVQAVDLMEKMLEMVPEKRITAAEAM
LHPYLRDLIEPHHHAEDTAPVYDQNFENLVLPVKCWKELVANEIRNF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagttcgtgaaagtggcaattaacgaacgcctttgggagttccccgacatatac
gagttcgtttgttttctgggtggcggttcctttggccaggtagctaaggtgagactacga
ggcaccgaaaattacgtcgctatgaaaaggcttatgcacccattcgagagggaggaggat
gctaagggtgcctatcgcgagatccgtctgctgaagcatatgaatcatagaaatgttatc
agcctgctgaacgtctttcatccaccagggcacaacatgatggattttaagcaggtttat
ttggtgactcacctgatggacgcggacctgcacaggtactcgcgttcgaaaaggatgagc
gacaatgagattaggataatcctttaccaaatactgcgggggctgaagtacatacacagt
gccggggttgttcatcgtgacttgaagccctgcaatatcgcagttaatggaaatagcgag
gtgcgcatacttgacttcggtttatcccgtatgtgcgcagacaatatgacggactatgtg
ggaactctgtggtatcgagctccggaaattatcttcctcaggggtcagtacacaaaggca
atcgacgtgtggtcggttggttgcattctggcggaacttatcacggggcgtgtcctgttc
cccggtgaaaactatccaagccaaatacgatgtctgattgacataatcggtactccgacg
agggagtttatcaccggaataagcatggaaaaatcgcgtagcttcctggagaggtatccg
ttacgccaaaggtgtgattttcaccacctatttatgggtaccgatgtccaggctgtcgat
ttgatggaaaaaatgctcgaaatggttcccgaaaaacgcataacagctgcggaagcaatg
ctccatccataccttcgggatcttattgagccacaccatcatgccgaagacaccgcacca
gtctatgatcagaacttcgaaaacctagtgctgcctgtaaaatgctggaaggaacttgtt
gccaacgagattcggaacttctga

DBGET integrated database retrieval system