KEGG   Drosophila sechellia: Dsec_GM24208Help
Entry
Dsec_GM24208      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM24208-PA
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dse  Drosophila sechellia
Pathway
dse03040  Spliceosome
dse04141  Protein processing in endoplasmic reticulum
dse04144  Endocytosis
dse04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dse00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dsec_GM24208
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsec_GM24208
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dsec_GM24208
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dsec_GM24208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dse01009]
    Dsec_GM24208
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dse03041]
    Dsec_GM24208
   03009 Ribosome biogenesis [BR:dse03009]
    Dsec_GM24208
   03110 Chaperones and folding catalysts [BR:dse03110]
    Dsec_GM24208
   04131 Membrane trafficking [BR:dse04131]
    Dsec_GM24208
   03051 Proteasome [BR:dse03051]
    Dsec_GM24208
   03029 Mitochondrial biogenesis [BR:dse03029]
    Dsec_GM24208
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dse04147]
    Dsec_GM24208
Protein phosphatases and associated proteins [BR:dse01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dsec_GM24208
Spliceosome [BR:dse03041]
 Complex B
  Other components
   Prp19 complex
    Dsec_GM24208
 Complex C
   Prp19-CDC5 complex
    Dsec_GM24208
Ribosome biogenesis [BR:dse03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dsec_GM24208
Chaperones and folding catalysts [BR:dse03110]
 Heat shock proteins
  HSP70 / DNAK
   Dsec_GM24208
Membrane trafficking [BR:dse04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dsec_GM24208
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dsec_GM24208
Proteasome [BR:dse03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dsec_GM24208
Mitochondrial biogenesis [BR:dse03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dsec_GM24208
Exosome [BR:dse04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dsec_GM24208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 6606301
NCBI-ProteinID: XP_002031106
FlyBase: FBgn0179072
UniProt: B4HE00
AA seq 651 aa AA seqDB search
MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFDVVSADGKPKIEVTYKDEKKTFFPEEIS
SMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTH
FVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRA
RFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKN
GLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELE
GVCNPIITKLYQAAGGAPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagctcctgctgttggtattgatttgggcaccacctactcgtgcgtgggcgtg
ttccagcatggcaaggtcgagatcatcgccaacgaccagggtaatcgtaccactccatcc
tatgttgccttcaccgatacggagcgtctgatcggagatgccgccaagaaccaggtggcg
atgaacccgacccagacgatcttcgacgccaagcgcttgattggtcgcaagttcgatgat
gccgccgtgcagtctgacatgaagcactggcccttcgatgtggtcagcgccgatggcaag
cccaagatcgaggtgacctacaaggacgagaagaagaccttcttccccgaggagatctcc
tcgatggtgctcaccaagatgaaggagaccgccgaggcctatctgggcaagactgtgacc
aacgctgtcatcaccgtgccggcctacttcaacgactctcagcgtcaggcgaccaaggac
gccggaaccatcgccggtctgaatgtgctgcgtatcatcaacgagcccactgccgctgct
atcgcttacggtctggacaagaaggctgttggagagcgcaacgtgcttatcttcgatctg
ggcggcggcaccttcgatgtgtccatcctgtcgatcgatgacggtatcttcgaggtcaag
tccacggccggagatacgcatctgggtggtgaggacttcgacaaccgtctagtcacccac
ttcgtgcaggagttcaagcgcaagcacaagaaggatctgaccaccaacaagcgtgctctg
cgtcgtctgcgcaccgcttgcgagcgtgcaaagcgtaccctgtcgtcctccacccaggcc
agcattgagatcgactctctgttcgagggtaccgacttctacacctcgattactcgtgcc
cgtttcgaggagttgaacgctgatctgttccgcagcaccatggaccccgtggagaaggct
ctgcgtgacgccaagctggacaagtcggtcattcacgacattgtgctggtcggtggctcc
acccgtatccccaaggtccagcgcctgctgcaggatctgttcaatggcaaggagctgaac
aagtcgatcaaccccgatgaggctgtggcctacggtgctgccgtccaggccgccattctg
cacggcgacaagtcgcaggaggttcaggatctgctgctgctcgatgtgactcctctgtcc
ctgggtatcgaaaccgctggcggtgtgatgagcgtgttgatcaagcgcaacaccaccatc
ccgaccaagcagacccagaccttcaccacctactcggacaaccagcccggtgtgctgatt
caggtgtacgagggcgagcgtgccatgacgaaggacaacaacctgctcggcaagttcgag
ctgtcgggcatcccccccgcacctcgtggtgtgccccagatcgaggtcaccttcgatatc
gatgccaacggtatcctcaatgtgactgccctggagcgttcgaccaacaaggagaacaag
atcaccatcaccaacgacaagggtcgtctgtccaaggaggacatcgagcgcatggtcaac
gaggccgagaagtaccgcaacgaggatgagaagcagaaggagaccattgccgccaagaac
ggcctcgagtcgtactgcttcaacatgaaggccaccctcgacgaggacaacctgaagacc
aagatctcggactctgaccgcaccacgatcctggacaagtgcaacgagaccatcaagtgg
ctggatgccaaccagctggctgacaaggaggagtacgagcaccgccagaaggaactggag
ggtgtgtgcaacccgatcattaccaagctgtaccaggccgccggtggtgctcccggtggc
atgcccggcggtcccggaggtatgcccggagcggctggtgccgctggcgctgccggagcc
ggcggtgctggccccaccatcgaggaggtcgactaa

DBGET integrated database retrieval system