KEGG   Drosophila sechellia: Dsec_GM24227Help
Entry
Dsec_GM24227      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM24227-PA
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dse  Drosophila sechellia
Pathway
dse00280  Valine, leucine and isoleucine degradation
dse00410  beta-Alanine metabolism
dse00640  Propanoate metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
Module
dse_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dsec_GM24227
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dsec_GM24227
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsec_GM24227
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Dsec_GM24227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 CHIPS TBPIP
Motif
Other DBs
NCBI-GeneID: 6606268
NCBI-ProteinID: XP_002031073
FlyBase: FBgn0179091
UniProt: B4HM22
AA seq 351 aa AA seqDB search
MALSVRQSSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKG
TGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIINGITMGGGVGL
SVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGGDVFYS
GIATHYCESSKIPDLETALLNCPDADDVPELLQKYHSTPEKPFSLQPVLEQINKNFSADS
VEGILENLQNDGSEWAKKTLETLSKMSPTSIKVTFRQLELGSQLSLAQCLIMEYRLAVHH
LERSDFKEGVRALLIDKDQKPQWQPTKLADVTEEHVQWFFRKLPDTEELKL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccctctccgtccgccaatcctcctcctccgtgctggccacggagtcttctaataag
ggaatgattattctaaaccgtcccaaggcgcttaatgccatcaacttggagatggtacgc
aagatctacaagcacctgaagaagtgcgagaagtccaagtcgctggtgatcatcaagggc
acaggtgacaaggccttctgcgccggtggagatgtgcgcgctctggtcgaggctggccct
acggatgagtcgaagagctttttccgggaggagtacagcacgaatgccctgatcgggaac
tataagattccctacatcgccatcatcaacggtattaccatgggcggtggcgtgggtctg
agtgtgcacggcaagtaccgggtggccagcgatcggacgctgtttgccatgcccgagacg
gcgattggcctcttcccggatgtgggtggatcatacttcctgcctcgactgcagggaaag
ctgggcctctacctgggtctcacaggatatcgactgcgcggcggcgatgtcttttactca
ggcattgccacgcactactgtgagagcagcaagatccccgatctggagacggctctcctt
aactgtccggatgcggatgatgtgcctgagctgctgcagaagtaccattccacgccagaa
aagcccttttcgctgcagcctgtcctggaacagatcaacaagaacttttcggcggactcg
gtggagggaatcctagagaatctgcagaacgatggtagtgaatgggccaaaaagacgctt
gagacgctctcgaagatgtctcccacctcgataaaggttacgttccgtcagttagagctc
ggatcacagctttcgctggctcagtgtcttattatggaatatcgtctggccgtgcatcat
ctggagcgcagtgatttcaaggagggagtgcgtgcccttctcatcgacaaggatcagaag
ccccagtggcagccaaccaagctggccgatgtcaccgaggagcatgtgcagtggttcttc
cgcaagctgccggacaccgaagaactcaagctgtaa

DBGET integrated database retrieval system