KEGG   Drosophila sechellia: Dsec_GM24577Help
Entry
Dsec_GM24577      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM24577-PA
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dse  Drosophila sechellia
Pathway
dse00564  Glycerophospholipid metabolism
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dsec_GM24577
Enzymes [BR:dse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     Dsec_GM24577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 6605607
NCBI-ProteinID: XP_002030425
FlyBase: FBgn0179440
UniProt: B4HH86
AA seq 515 aa AA seqDB search
MPFAHEQLNLVAREQLSKTETIKLRNQHIGQACQLFYRSDPLKIVRGQGQYMFDEEGTRY
LDCINNVAHVGHCHPEVVRAGALQMATISTNNRFLHDELVQCARTLTSKMPEPLSVCFFV
NSGSEANDLALRLARNFTKRQDVITLDHAYHGHLQSVMEVSPYKFNQPGGEAKPDYVHVA
PCPDVYGGKFTDKIYPDADMGALYAQPIEEICQKQLAKGHGVAAFIAESLQSCGGQILPP
AGYFQAVYDAVRSAGGVCIADEVQVGFGRVGSHYWAFRDPKRNPRHCVCGQAHGQRSSGG
CGCHHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEFECIGDVRGAGLFVGIELVQDRKERIPDKKAAH
WVVNRMKQLHRVLVSSDGPNDNVIKLKPPMCFNRENADEFLLGFRECLTAVMQERLASAT
SAAMAATSGVIATAAETLANKTKLFERQDRLIKSV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgcccacgagcaactgaatctggtggccagggagcagctgagtaaaacggag
accatcaagctgcgcaaccagcacatcggacaagcctgccagctcttctatcgctctgat
ccactgaaaattgtgcgcggacaaggtcaatatatgttcgatgaggagggtacccggtat
ctggactgcatcaacaatgtggcccacgtgggtcattgccatcccgaggtggtgcgagct
ggagccctgcagatggcgaccatctccacgaacaaccgcttcctccacgatgaactggtc
cagtgtgctcgcacgttgaccagcaaaatgccggagcctctgtccgtttgcttctttgtc
aattccggatccgaggctaatgacctggccctgcgactggcccgcaactttactaagcgt
caggatgttatcactctcgaccatgcctatcatggtcatctgcagtcggtcatggaggtg
tcaccatacaaattcaaccagcccggcggcgaggccaagcccgactacgtgcatgtggct
ccctgtccggacgtttatggcggaaagttcacggataagatatatccggatgctgacatg
ggtgccctgtatgctcagcccattgaggagatctgccagaagcagttggccaagggccac
ggcgtcgccgccttcatcgccgagagtctgcagagttgcggtggccagattctgccacca
gctggatacttccaggcagtctacgatgcggtacgctctgccggaggcgtgtgcatagct
gacgaggttcaggtgggatttggacgcgtgggcagtcactactgggcctttcgagaccca
aaacgtaatccccgacattgtgtgtgtggccaagcccatgggcaacggtcatccggtggg
tgcggttgtcaccactccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnngaattcgagtgcattggcgatgtgcgaggcgctggacttttc
gtgggcatcgagctcgttcaggatcggaaggagcgcattcccgacaagaaggctgcccac
tgggtggtcaaccgaatgaagcagcttcacagggtgcttgtctcctccgacggtcccaac
gataacgtgatcaagctaaagccgcccatgtgcttcaaccgggagaatgcggatgagttc
ctgctgggattccgggagtgtttgaccgccgtgatgcaggagcgcctggccagtgccaca
tccgccgccatggctgccaccagtggtgttattgccaccgccgctgagacgctggccaac
aagacgaaactcttcgagcggcaggatcgcctcatcaagtccgtctga

DBGET integrated database retrieval system