KEGG   Drosophila sechellia: Dsec_GM24706Help
Entry
Dsec_GM24706      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM24706-PA
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dse  Drosophila sechellia
Pathway
dse00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsec_GM24706
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dsec_GM24706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 Phage_TAC_6 COX16
Motif
Other DBs
NCBI-GeneID: 6605345
NCBI-ProteinID: XP_002030180
FlyBase: FBgn0179569
UniProt: B4HEZ7
AA seq 313 aa AA seqDB search
MTEFDFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIE
KENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYVDLV
VKVYFKDTHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKH
VTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQK
HPDQFKVWYTVDKANEGWQYSVGYINEEMIAAHLLPAKDDTIVLLCGPPPMINFACNPAL
DKLGYHPDTRFAY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattcgattttgtgccactcgccgtgggtgtggtcgccgtactcgccggcgcc
ctgatcgtccactatctgctgaataagaagtccacgaaaccacgccgggaacccaatcgc
accgctcggctgcgcacgcttgtggatcccaacgacaagtacctgctgcctctcatcgaa
aaggagaatctgagccatgacactaggagattccggttcggattgccctccaagcagcat
gtccttggcctgcccgttggccagcacattcatctgatcgctaccattgacaatgagctg
gtaattcggccatacactccgatatcgtccgatgaggatgttggctatgtggacctggtc
gtcaaggtgtacttcaaggacacgcatcccaagttcccggccggcggcaaaatgacgcaa
cacctggagcaactcgagttgggggacaagatctcgttccgtggtccctcgggtagactg
caatatctcggcaatggcaccttctccatcaaaaagttgcgcaaggatccgcccaagcac
gtgaccgccaagcgagtcaacatgattgccggcggcactggcattactccaatgctccaa
ttggccagggaagtgctcaagcgcagcgataaggataagactgagctggcgttgctgttc
gccaaccagagcgaaaaggacattctgctgcgtgcagagctggacgaattggcccagaag
catcctgaccagttcaaggtctggtacacagtggacaaggcaaacgaaggttggcagtat
agcgttggctacatcaatgaggaaatgatcgccgcccacctgcttccggccaaggacgat
accatcgtgttgctttgcggcccaccacccatgattaactttgcctgcaatccggcgctg
gacaagcttggctaccatccggacacccgttttgcctactaa

DBGET integrated database retrieval system