KEGG   Drosophila sechellia: Dsec_GM25224Help
Entry
Dsec_GM25224      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM25224-PA
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dse  Drosophila sechellia
Pathway
dse00230  Purine metabolism
dse01100  Metabolic pathways
Module
dse_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dsec_GM25224
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dsec_GM25224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 AAA_18 MMR_HSR1 ABC_tran RsgA_GTPase AAA_29 RNA_helicase AAA_21 Mg_chelatase ATPase_2 AAA_5 NACHT AAA_17 Rad17 cobW Pox_A32 AAA AAA_14 G-alpha AAA_28 AFG1_ATPase AAA_24 Roc HGTP_anticodon2 AAA_23 T2SSE
Motif
Other DBs
NCBI-GeneID: 6605176
NCBI-ProteinID: XP_002030015
FlyBase: FBgn0180084
UniProt: B4HDR1
AA seq 234 aa AA seqDB search
MISFLFIVNRALSSSSSSISSAAASLTNKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEF
PSTFGFSISHTTRKPREGEDHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAV
REIQAQGRVCILDIEQKGVEQIRRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKR
LNAAQVEIDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELEEQQKQGVSVNLK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgggcgctcagcagcagcagcagcagcatcagc
agtgcagcggcatccttaacgaacaagaagatgaccgcccccggcccacgaccccttgtc
ctgtgcggaccctcgggatccggaaagagtacgctgctcaagaggctgttcgccgaattc
cccagcacctttggcttcagcatatcgcacaccacgcggaagccgcgtgagggcgaggat
catggggtgcactactactttgtggaacgcccggaaatggaggcagccatcgccggcgac
gagttcatcgagacggccgagtttacgggcaatctgtatggaacgagcaaggcggcggtt
agggagatccaggcacagggacgggtctgcatactggacatcgaacagaagggagtggag
cagatccgtcgtacggatctcaatcccatactgatcttcaacaatccaccgagcatcaag
gagctggagcgacgacttcgcaaacgtggctccgaaacggaggagtcgctgagcaagcgc
ctcaatgccgcccaggtggagatcgattatggtttgacgcccggcaacttccacaagatc
atcaacaacgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtccaggaa
ctcgaggagcagcagaagcagggagtatcagttaacttgaagtaa

DBGET integrated database retrieval system