KEGG   Drosophila sechellia: Dsec_GM25238Help
Entry
Dsec_GM25238      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM25238-PA
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dse  Drosophila sechellia
Pathway
dse01040  Biosynthesis of unsaturated fatty acids
dse01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dsec_GM25238
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dsec_GM25238
Lipid biosynthesis proteins [BR:dse01004]
 Desaturase
  First
   Dsec_GM25238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 6605203
NCBI-ProteinID: XP_002030041
FlyBase: FBgn0180098
UniProt: B4HDT7
AA seq 354 aa AA seqDB search
MPPNTKDTTGVLYESDAQVDSGLSTELSNTKTTDGRKLELVWFNIVLFLILHISSLYGVW
LLFTSATWTTFVLFSPAVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAV
YYWARDHRVHHKYTETDADPYNSKRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPL
IMFQKKYYLLLMPIICFVLPTVVPMYLWGESLNVSWHVMTLLRWCISLNLIWTVNSSAHM
HGMRPYDKNICPVDQSFLIFFHVGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAY
LGWAYDLKSVSLDSVKQRAQRTGDGSHPVWGWGDKDQLKEDVGVTTISHHRNGK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaataccaaggacactaccggagtgctttacgaatctgatgcgcaagtagac
agtggattgtcgacggagctgagcaatacgaagaccaccgatggcaggaaactggagctg
gtatggttcaatatagtgttgttcctgatccttcacatatcttcgctatatggagtgtgg
ctgttattcacttcggccacgtggacaactttcgtgctcttttcgccagcggttgtggtg
accattttgggagtttccggcggtgcccatcgtttatgggctcatcgtaccttcaaggcg
aatacaccgctcaagctgatctttttgttcctgaacactttggccttccaggatgcggtc
tactattgggcccgggatcatcgtgtgcaccacaagtatacggaaactgatgcggatccg
tacaattccaaacgtggctggttctttgcccacataggatggttgtgctgccgaaagcat
ccggaggttgtggagaagggcaagcaaatagatctatccgatctggaggcagatccactg
atcatgttccagaagaagtactatctgctgctgatgccaatcatatgctttgtcctgccc
accgttgtgcccatgtatctgtggggcgaatcactcaatgtgtcctggcacgtgatgacc
ctgcttcgatggtgcatcagtctgaatctcatctggacggtcaatagctcggcccacatg
cacggcatgcggccctacgacaagaacatatgtccagtggatcagagcttcctcatattc
tttcatgtgggtgagggataccacaactaccaccatgtctttccctgggactacaagagc
gccgagctgggcaagtattcgcaggatgtgaccaccaagttcatcgaattcatggcctat
ttgggttgggcctacgatctcaagagtgtctcactggattcggttaagcagcgagcccag
cgcactggcgatggatcacatcctgtttggggatggggcgataaggatcaactaaaggag
gacgtgggcgtgaccaccattagtcaccaccgaaatggaaagtaa

DBGET integrated database retrieval system