KEGG   Drosophila sechellia: Dsec_GM25805Help
Entry
Dsec_GM25805      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM25805-PA
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
dse  Drosophila sechellia
Pathway
dse00500  Starch and sucrose metabolism
dse01100  Metabolic pathways
Module
dse_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dsec_GM25805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dse01003]
    Dsec_GM25805
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dsec_GM25805
Glycosyltransferases [BR:dse01003]
 Polysaccharide
  Storage polysaccharide
   Dsec_GM25805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 GSIII_N
Motif
Other DBs
NCBI-GeneID: 6606320
NCBI-ProteinID: XP_002031125
FlyBase: FBgn0180661
UniProt: B4HE19
AA seq 709 aa AA seqDB search
MRRQQSYRFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFM
IAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSDITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA
GRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGS
KNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacagcagtcctaccgtttcgaggacaacgagtccacctcttacgccctgagg
atgaatcgtcgcttttcgagagtggagtccggggcggaccttaaggattatttcgatcgg
ggtgatatcgcttcccgggagaaccgctggaacttcgaggtggcatgggaggtggccaac
aaggtgggcggtatttacacggtgatccggtcgaaggcatatgtctccaccgaggagatg
ggcgagcagttgtgtatgatgggtccctacaaggagcactgtgcccgcaccgagatggag
gagatggagttccccaggggaaaccccctactagacgctgtcaattcattgcgctcgcga
ggctataaaatccacaccggtcgctggctggtggacggaaatcctcaattaatccttttc
gatattggatcagccgcctggaagctggatcagttcaaatcggagatgtgggagaagtgc
catattggaatacctcatttggatatcgagacgaacgatgccattatccttggctttatg
attgccgagttcctggaggagttccgcaactttgccgtgacttattcgcaaaacaacgaa
ctgagcgctccgaggattgtcgcccacttccacgaatggcaagctggcgtgggactcatt
gtcctacgtactcgtctggtggagatcgccactgtgttcactacccacgccacattgttg
ggtcgttacttgtgcgccggcaacaccgatttctacaacaatctggacaagttcgccgtg
gacgaggaggcgggcaagcgccaaatctaccatcgctattgcctggagcgaggtgccact
cacttggctcatgtgttcaccaccgtctccgatattacgggctacgaggcggagcatcta
ctcaagcgcaaaccggacatcatcacgcccaatggactgaacgtgaagaagttctcggcc
atccacgagttccagaacttgcacgccgttgccaaggagaagatcaacgaattcgtgcgg
ggtcacttttacggccacattgactttgatttagataagaccctgtacttcttcatcgcc
ggtcgctacgagtttggcaacaagggagccgacatcttcatcgaggcactggctcgcttg
aacgcgatgctcaagcacgagaagccggacaccacggtggtggccttcctcatcttcccc
accaagaccaacaacttcaacgtggactcgctgcgaggacatgccgttatcaagcagttg
cgcgatacgatcaacaacgtccagcaggccgtgggcaagcggatgttcgacacttgcctg
cagggcaacatacccaatgccgatgatctgcttcagaaggatgacctggtcaagatcaag
cgttgcatgttcgccatgcagcgcgattcgatgccgcctgttaccacgcacaatgtggct
gatgactggaatgatccggtgctatcctcaatccgtcgttgccatctgttcaactcgcgc
cacgatcgtgtcaagatggtcttccatccggagttcctcacatccacaaatcctctgttt
ggaatcgactacgaagaatttgtccgtggctgccacttgggtgtcttcccctcatactac
gagccctggggttacactcccgccgagtgtacggtgatgggtatcccgagcgtaaccacc
aatctgtccggctttggctgcttcatggaggagcacatcagtgatccaaagtcctacggt
atctacatcgtggatcgccgctatatcggcttggagaacagcgttcagcagctgtccagc
tttatgatggagttctccaggctgaaccgccgccagcgcattatccagcgtaatcgcacg
gagcggttgagcgatcttctggactggcgcaccctgggcatttactacagacaggccagg
gttaaggccctgcaagctgtttacccagactatgtggatgaattgtctctttatggatcg
aagaacaacttgatcttctcgcgaccgcacagcgaacctcccagtcctacttcatcgcgg
cacaccactccagctccatcggttcacggttcggatgacgaggactccgtggatgaggag
accgaactcaaggaattggggattaagtag

DBGET integrated database retrieval system