KEGG   Drosophila sechellia: Dsec_GM26332Help
Entry
Dsec_GM26332      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM26332-PA
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dse  Drosophila sechellia
Pathway
dse04013  MAPK signaling pathway - fly
Module
dse_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM26332
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsec_GM26332
Protein kinases [BR:dse01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dsec_GM26332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6607241
NCBI-ProteinID: XP_002032022
FlyBase: FBgn0181185
UniProt: B4HLI1
AA seq 424 aa AA seqDB search
MAERPKNLFATGSSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTR
CFGAQQPQQTPPVASSQVPPVPAASSSSAADRHRERIRQQACGKLQFGEGAANTHTFTSD
DLEDEGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIY
IVQFYGALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLK
EELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA
KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEF
VDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMEKDGITQFTANQ
QAES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgaccgaaaaatttgtttgcaaccggatccagtcgctcccgcaatcccccg
gatcagctaagcctgaataatcttagcatacgccatccgccctcgtccacgtcgtccact
tcttcgggatccacatcctcgggctcaagttcctcttcacagcataaccatgttacccgc
tgttttggcgcccagcagccacagcaaaccccgccggtggccagcagtcaagtgccaccg
gtaccggcagcatcgagcagcagcgctgccgatcgtcaccgggagcgaattcgccagcag
gcctgtggcaagctacagtttggtgagggcgctgccaatacacacacatttacttcagac
gatctcgaggatgagggcgaaattggacgcggtgcatttggggcagtcaacaagatgatt
tttaagaaactagacaaggtgatggccgttaagcgcattcgatccaccgtagacgagaag
gaacagaagcagctgctcatggatctcgaggtggtcatgaagtccaacgagtgcatctac
attgttcagttctatggggcgctgtttaaggagggagactgctggatttgtatggagctg
atggacacctcgttggacaagttttacaagtacatctatgaaaagcagcagcgccacatt
ccagagtccatactggctaagataacagtggccacggtcaatgcgctgaactatttaaag
gaggagctaaagattattcatcgggatgtgaaaccgagcaatattctgttgcaccgtcgc
ggagacataaagctgtgtgattttggtatatcgggtcagctggtcgactctattgccaag
accaaggatgcgggctgcaggccctacatggcgccggagcgcattgatccagagcgtgcc
aagggctacgatgtacgaagcgatgtttggtcattgggcatcactttgatggaggtggcg
actggtaatttcccctatcgtaaatgggactctgttttcgagcagttgtgtcaggttgtg
caaggcgaaccgccccgacttttgacatcctataacggcatggagttctccaaagagttt
gtggactttgtcaatacttgtctcattaaaaaggagagcgatcggcccaagtatagtcgt
ctgctggagatgcccttcatccgtcgtggtgagacgagccacactgatgttgccgtgtat
gtggccgatatactggagtcgatggagaaagacggcattacgcagtttacggccaaccag
caggcggagagttaa

DBGET integrated database retrieval system