KEGG   Drosophila sechellia: Dsec_GM26397Help
Entry
Dsec_GM26397      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM26397-PA
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dse03041]
    Dsec_GM26397
   03009 Ribosome biogenesis [BR:dse03009]
    Dsec_GM26397
Enzymes [BR:dse01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Dsec_GM26397
Spliceosome [BR:dse03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    Dsec_GM26397
Ribosome biogenesis [BR:dse03009]
 Eukaryotic type
  90S particles
   Helicases
    Dsec_GM26397
  Pre-60S particles
    Dsec_GM26397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 AAA_22
Motif
Other DBs
NCBI-GeneID: 6607374
NCBI-ProteinID: XP_002032147
FlyBase: FBgn0181250
UniProt: B4HM85
AA seq 680 aa AA seqDB search
MSIREKLLMKKIVKREKMKKELSQKKGNKKAQKQEPSKQNGNKPSKKPEILSKKHVAEDE
DDDLEEDFQEAPLPKKKQQKQPSKKQEIQVANSDSESDDDEQEDEADEDSDVDEVAEVDE
DDVDSGSEDDDQQEDEDEPEPVPAKKTKLLPNKSKAQNGKPAKDDKPFTVESSLAALDYR
DSDDRSFASLKGAVSEATLRAIKEMGFTEMTEIQAKSLTPLLKGRDLVGAAQTGSGKTLA
FLIPAVELINKLRFMPRNGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGLVMGGSNRQ
VESEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIIN
LLPKRRQTMLFSATQTARIEALSKLALKSEPIYVGVHDNQDTATVDGLEQGYIVCPSEKR
LLVLFTFLKKNRKKKVMVFFSSCMSVKYHHELFNYIDLPVTSIHGKQKQTKRTTTFFQFC
NAESGILLCTDVAARGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRP
EELGFLRYLKAAKVPLNEFEFSWQKIADIQLQLEKLIAKNYFLNQSAKEAFKSYVRAYDS
HQLKQIFNVNTLDLQAVAKSFGFLVPPVVDLKVGAAKRERPEKRVGGGGFGFYKKMNEGS
ASKQRHFKQVNRDQAKKFMR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcgggagaagctgctgatgaagaagatcgttaagcgggagaagatgaagaag
gagctctcgcagaagaagggaaacaagaaggcccaaaagcaggagccatccaaacaaaat
ggcaataaacccagtaaaaaacccgagatactcagtaaaaagcatgtggccgaggatgag
gatgacgacttagaggaagatttccaggaggcgccgctgcccaagaagaagcaacaaaaa
cagccttcaaaaaagcaagaaattcaggtggccaactcggattcggaatccgatgacgat
gagcaggaggatgaggcagatgaggatagcgatgtggacgaagtagccgaagttgatgag
gacgatgtggacagcggaagtgaagacgatgaccagcaggaagatgaagatgaaccagag
cctgtgccagccaagaaaacgaagttgcttcccaacaagtccaaggcacagaatggcaaa
ccagctaaagacgacaagccctttactgtggaatcctctctggctgctctggactaccga
gattcggatgatcgcagctttgcctccctaaagggcgccgtgtccgaggccacattgcga
gccattaaggagatgggttttaccgagatgactgaaattcaggcgaaatcactgacaccc
ctactaaagggacgcgatctggtgggtgctgcccagacgggttccggcaagaccctggcc
ttcctgatacccgccgtcgagctgataaacaagctgaggtttatgccacgcaatggcacc
ggtgtgatcatcatctcacctacccgagagctgtccatgcagactttcggtgtgctcaaa
gaactgatggcacaccaccatcacacttatggcttggtgatgggcggctccaatcggcag
gtggagagcgagaagttgggcaagggcatcaacatactggtggccacaccgggtcgtctg
ttggatcatttacaaaactcgcctgactttctgtacaagaaccttcagtgcctgattatc
gatgaagtggatcggattctggagatcggttttgaggaggagcttaagcaaattattaat
ctgctgccaaaacgccgccagacgatgctcttttcggccacacagacggctcgcatcgaa
gcgctttccaagctggcccttaagtcggagccaatttatgtgggtgttcacgataaccag
gacaccgcgactgtagatggactcgagcagggatacattgtgtgcccctcggagaagcgc
ctgctcgtgctcttcacgttcctcaaaaagaatcgcaagaagaaggtgatggtgttcttc
tcgtcctgcatgtccgtcaagtaccaccacgagcttttcaactacattgatctgccagtg
acctccattcacggtaaacaaaagcaaacgaaacgaacgaccactttcttccagttctgc
aacgcggaatctggaattctcttatgtacggatgtggctgctcgtggattggacattccg
caagtcgattggattgtgcagtacgatcctccagatgatccacgcgaatatattcacagg
gtgggccgaacggccagaggatcgggcacctcgggtcacgccctccttctgatgcgaccg
gaggagctgggcttcctgcgctaccttaaggccgccaaggtgccgctcaacgagttcgag
ttctcctggcagaagatagctgatattcaactgcagcttgagaaactgatcgccaagaac
tatttcctaaaccagtcggccaaggaagcctttaagtcgtatgtgcgcgcgtacgactcg
catcagttgaagcagatcttcaatgtgaacacgctggacctgcaggcggttgcgaaaagc
tttggattcctggtgccacccgtagttgacctgaaggtgggcgcggccaagcgggagcga
ccggaaaagcgagtgggcggcggcggttttgggttctacaagaaaatgaacgagggatcg
gcctccaagcagcggcacttcaagcaggtcaaccgcgaccaggccaagaagtttatgcgt
taa

DBGET integrated database retrieval system