KEGG   Drosophila sechellia: Dsec_GM26905Help
Entry
Dsec_GM26905      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM26905-PA
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dse  Drosophila sechellia
Pathway
dse00020  Citrate cycle (TCA cycle)
dse00640  Propanoate metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
Module
dse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsec_GM26905
   00640 Propanoate metabolism
    Dsec_GM26905
Enzymes [BR:dse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dsec_GM26905
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dsec_GM26905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 6619069
NCBI-ProteinID: XP_002043309
FlyBase: FBgn0181755
UniProt: B4IHU9
AA seq 342 aa AA seqDB search
MSLNRGSKMLLRAMTPQVLRRGKADYGKTVCNLKINKSTKLLVQGFTGKQATFHSEESIK
YGTNIVGGVNPKKGGTEHLGKPVFKSVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEI
GLIVAITEGIPQSDMVRISQMLNCQEKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVG
IVSRSGTLTYESVHQTTNVGLGQALCVGLGGDPFNGTSFIDALKVFLSDKEIKGIVMIGE
IGGSAEEDAADFLKEKNTGCEAKPVVGFIAGQTAPPGRRMGHAGAIISGGKGAAKDKVAA
LEKAGVRMTANPCHLGSTLLEEMIRLKLVPKPNAKKAQAGKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaatcgaggaagcaagatgctcctgcgggcgatgacgccccaagttttgagg
cgtggcaaggcggactacggcaagacggtgtgcaacctgaagatcaataagtcaacaaag
cttctagtccagggattcaccggcaaacaggccaccttccactcggaggagtccataaag
tacggaaccaacatagttggcggtgtgaatcccaagaagggcggtacggagcatctgggc
aagcccgtattcaaatcggttgcagaagctgtggagaaggcgaagccagatgccacggtg
atctttatcccacctccatccgccgccgagggtatttgtgcagccatcgagagtgaaata
ggcttgattgtggccattaccgagggtattccccagtcggatatggtgaggatatcgcag
atgctgaactgccaggagaagtcccgcctgctgggacccaactgcccgggaatcatctcg
ccggatcagtgcaaaatcggaataatgccgggagatatccacaagcgaggcgtggtgggc
atagtctcgcgctcgggaaccttgacctacgagtccgtccatcagaccaccaacgtggga
ttgggtcaggctctttgcgttggcctcggcggagatccctttaacggaaccagcttcata
gacgccctcaaagtatttctgtccgacaaggagatcaagggcattgtcatgatcggagag
attggcggatccgccgaggaagatgctgccgattttctcaaggagaagaacactggctgc
gaggccaagccagtggtgggcttcattgctggacagactgctccaccgggtcgtcgaatg
ggccacgccggcgccatcatttccggtggcaagggagcggccaaggacaaggtggccgcc
ttggagaaagcgggagtccgcatgaccgccaatccatgccacctgggctccacgctcctc
gaggaaatgatccgccttaaactggtgcccaagccgaacgcaaagaaggcccaggctggc
aagaagtag

DBGET integrated database retrieval system