KEGG   Desulfocapsa sulfexigens: UWK_01315
Entry
UWK_01315         CDS       T02473                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00230  Purine metabolism
dsf01100  Metabolic pathways
dsf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UWK_01315
Enzymes [BR:dsf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     UWK_01315
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGF77876
UniProt: M1PN57
Position
1485841..1488123
AA seq 760 aa
MAVGQSHIRKDVRAKVTGKTRYTDDFSMPGMLHAKYVRSPIAHGLVKSIDTTAALAIPGV
EAVFTHEDVPKILFATAGHPFSLDPDHQDVADRLLLTDHVRYHGDEVAIVVARDLLTAAQ
AAKAVIVEYEELPVCVTSEAAMAEDAPAIHPGGNSIKSTTFEIGGKLEDAEKEADLVVED
TFSTPIILHCHLENHVAYAYMDDNDHIVVVSSTQIPHICRRIVGQALDMPWPKIRVIKPY
IGGGFGNKQDVVLEPMVAFLTRKLGGVPVKIELEREEGLVATRTRHGQTVTARAGVSNDG
IIKFIDLNVISNTGAYASHGHSIPMAAGSKFCNLYPRSVSKFSATTHYGNIPAAGAMRAY
GSPQLFFGVESVLEEVARKLGMDSVDFRIKNSARPADIISKTGNKEHSVGMVECLEKGRE
AIGWDVKKEVYARQEGNIRRGLGVASFSYGSGTYPACVEIAGCRLVLNQDGTVHMQIGAT
EIGQGSDTALAQMAAETLGVDYDAIHVVSEQDTDVSPFDPGAYASRQTYVAAPAVHRAAG
KLKAQILEHYQLMTGEEAETLDLTGGKIIRRDQPESVLLDLHDLALDSYYHKERGGQLTA
EVSSKTCTNAPSYGCTFVDLEVDIEMCTVTIRQIINVHDAGKIIHPLSAEGQVHGGMGMG
VGMALFEELLVDPESGRIYNGNLLDYKIPTCVDIPDLQCAFVETFDPTSPYGNKSLGEPP
IISQGPAIRNAIWDATGVKINEIPMTPKVLFKHFKNAGLI
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcagtaggacaatcacatatacgaaaagatgtcagggcaaaggttaccggaaaaacc
cgttataccgatgatttcagtatgcccggtatgctgcatgcaaagtatgtcaggagcccc
attgcccatgggcttgttaagagtattgacacgactgcggcactagctataccaggggtc
gaggctgtgtttacccatgaggatgtccccaaaattcttttcgcaacggctggccatccc
ttttcccttgatcctgatcatcaggatgtggcagacagattattgctgaccgatcatgtc
cgttatcatggtgatgaggtggccatagtggtggcccgtgatcttctcaccgcagcacag
gcggcaaaggcagtgattgtcgaatatgaggaacttcctgtctgtgtcacttccgaggct
gccatggctgaggatgcccctgccatacatccgggtggaaatagtattaaatccaccact
tttgagatcggtggaaagcttgaagatgcagagaaagaggcggatctcgttgtcgaggat
accttcagcacgccaattattcttcactgtcatctggaaaaccatgtggcatacgcctat
atggatgacaacgaccatatcgttgttgtcagttccacccagattccccatatctgccgc
aggatagtcggccaggcacttgatatgccgtggccaaagatccgtgtcattaagccctat
atcggcggtggttttggcaacaagcaggatgttgtcctcgaaccgatggttgcttttctc
accaggaaacttggtggcgttccggtcaaaattgaactggaacgcgaagaaggtcttgtt
gctacccgcacccgtcatggtcagaccgtcacggcccgtgccggggtgagcaatgacggt
atcataaaatttattgatctgaacgtgatctctaataccggagcctatgcatcccacggg
cactccattcccatggctgcaggatcaaaattctgtaacctctatccgcgcagtgtctca
aaattttcagcgaccactcattacggaaatattcctgcggccggggccatgcgggcttat
ggctctccccagttgtttttcggtgttgaaagtgtccttgaagaggttgcccgtaagctt
ggtatggattccgtcgatttccgcatcaaaaactcggccagacctgctgatatcatctcc
aagacaggaaataaggaacactctgttgggatggtagaatgtctcgaaaaagggcgtgag
gccataggctgggacgtgaaaaaagaagtatatgccaggcaggaagggaatattcgccgg
ggactcggagtggcctccttcagctacggttccggtacctatccggcctgtgtggagatt
gcaggttgtcggcttgtgcttaatcaggacggaacggttcatatgcagataggagccaca
gaaattggtcagggatccgatacagcgctggctcagatggctgcagaaacacttggggtt
gactacgatgcaattcatgtggtctcggaacaggataccgatgtctcaccatttgacccc
ggggcctacgcctcacgtcagacctatgttgccgctccagcagtccaccgggcggcagga
aaactaaaggcacaaatccttgaacattatcagctgatgacgggtgaggaggcagagact
cttgatcttacaggtggaaaaataattcgcagggatcagccggagagcgtgttgcttgat
ctgcacgatctggcactcgacagctattaccataaagaacgcggtggacagctaaccgcc
gaagtatcaagcaagacctgtaccaatgcacccagttatggatgcacctttgttgatctt
gaagtggatattgaaatgtgcaccgtcaccatcagacagatcatcaatgtccatgatgca
gggaaaataatccacccactctctgctgagggtcaggttcatggtggaatggggatgggt
gtcggcatggccctgtttgaagagttgctggttgatcctgaaagcggcaggatttataat
ggaaatctgctggattataaaatccccacctgtgtagatattccggatcttcagtgtgct
tttgtggaaacctttgaccccacgagtccttatggtaataaatccctgggtgagcctccc
attatttcccaggggcctgctattcgtaacgcgatatgggatgcaaccggggtgaaaatc
aatgagatccctatgacccccaaggttttgtttaagcattttaaaaatgcaggacttatc
tag

DBGET integrated database retrieval system