KEGG   Desulfocapsa sulfexigens: UWK_01317
Entry
UWK_01317         CDS       T02473                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00230  Purine metabolism
dsf01100  Metabolic pathways
dsf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UWK_01317
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AGF77878
UniProt: M1P327
Position
1489107..1489577
AA seq 156 aa
MQTMNIKLTINTKKYEMAVDVRKSLMDLLRELGYTSVKHGCGVGECGACTVLVDNIPVDS
CLYLATWANNRAIRTTEGECRDGKLSSVQEAYVEEGAVQCGFCTPGLIMTTTSFLEKNKG
KELSREEIKKGHAGNLCRCTGYQTIINAVETAGKNG
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagaccatgaatatcaaattgacgattaacaccaaaaagtatgagatggctgtcgat
gtgcgtaaatcccttatggatctgctccgtgagcttggttacaccagtgtgaagcatggc
tgtggcgtgggggaatgcggagcttgtaccgtgcttgtagacaatattccagtcgattcc
tgcctctatcttgcgacctgggcaaataacagggcaatacgcaccaccgaaggcgagtgc
cgggatggaaaactttcttctgtccaggaggcctacgtggaagaaggcgctgttcagtgc
ggtttttgcactcccggtcttattatgaccaccacttctttcctggagaagaataagggg
aaggaactgtcccgtgaagagattaaaaagggtcacgcgggtaatctttgtcgctgtacc
ggataccagaccatcataaatgcggtggaaacggccggtaaaaatggttaa

DBGET integrated database retrieval system