KEGG   Desulfocapsa sulfexigens: UWK_01619Help
Entry
UWK_01619         CDS       T02473                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00450  Selenocompound metabolism
dsf00970  Aminoacyl-tRNA biosynthesis
dsf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UWK_01619
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UWK_01619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dsf01007]
    UWK_01619
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dsf03016]
    UWK_01619
Enzymes [BR:dsf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UWK_01619
Amino acid related enzymes [BR:dsf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UWK_01619
Transfer RNA biogenesis [BR:dsf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UWK_01619
 Prokaryotic type
   Other AARSs
    UWK_01619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 MecA tRNA-synt_1f Med26_C
Motif
Other DBs
NCBI-ProteinID: AGF78177
UniProt: M1P935
Position
1814641..1816587
Genome map
AA seq 648 aa AA seqDB search
MTTYITTPIYYVNAQPHLGHAYTTIVADTYARFRRLSGDTVRFQTGTDEHGDKIAEAAAK
EGESPKQYVDRISGMFRETWPLLDIAPDHFIRTTDSDHVATVQSILQQVYDKGDIYFDQY
SGLYCTGCERFLTEKELVDGKCPDHQTTPNELAEENYFFRMSKYQQELIDHIHAHPDFIT
PERYRNEVLSFLSEPLEDLCISRPTSRLTWGIPLPFDENFVTYVWFDALINYLTGIGYPD
GDQFAEYWAVAEHVIAKDILKPHAIYWPTMILAMGLPLYRKLHVHGYWNVEDTKMSKSIG
NVVRPAELIEEYGVDSIRYFTLREMSFGLDASFSSDAIIARKNSDLANDLGNLYSRSTAM
LFKYTDGVVPLPVSADDDNVLSDLAEKVFSTYREAMNTFQFHRGLQAIWELISQANKYIV
TNEPWTLVKDPGQIGRLHTVLYNLAETLRILTLLLQPVMPGTCKKMAEGLGLEEDSALIQ
DLMLNGGWGKLEPKTVLQKSDALFPRVDTKKKQQHLEQESQKNTKKAAKKKQQEEKTEGV
ISFDQFQKVELRVAEIVTAEAVKKSDRLLKLTVRAPEERVIVAGIAEFYQPEDLPGMQVL
IVANLQPVKLMGVESQGMVLAAKTEVDGKNRLVLSAVSAPVPPGSRVA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatatcacaaccccaatttattacgtaaatgcccagccgcatctggggcac
gcctataccaccatcgtcgctgatacctatgccagatttcggcgtttgagcggggataca
gtcagattccagactggaaccgatgaacatggtgacaagatagcagaagcagcagcaaag
gaaggagagagccctaagcagtatgttgatcgaatcagtgggatgttccgtgaaacctgg
ccactgctcgatattgctccggatcatttcattcgtaccaccgatagtgatcatgtggct
acggtccagtctatactgcagcaggtctatgataagggtgatatctattttgatcaatat
tctggtttgtactgcacgggttgtgagcgatttctgacggaaaaggaactggttgatggg
aaatgtccggatcatcagaccacgcccaatgaattagctgaagagaattattttttccgg
atgtcaaagtatcagcaggaactgattgatcacattcatgctcatccggactttataacg
ccggagcgctacaggaatgaagtgctctcctttttgagcgagcctctggaggatctctgt
atttcacgaccaacttcacgccttacctgggggattcctctgccctttgatgaaaacttt
gtaacctatgtctggtttgatgccctcatcaattatcttaccgggattggctatccggat
ggagatcagtttgcagagtactgggctgtcgctgagcacgtgatagccaaggacattctg
aaacctcatgctatttactggccaaccatgatacttgccatggggctgccgctctatcga
aaactccatgtccatggttactggaatgtagaagacaccaagatgtccaaaagtataggg
aatgttgtgcgacctgctgaacttatcgaagagtatggggtggatagtatccgttatttt
accctgcgcgagatgtcttttggactggatgcatcgttcagctccgatgcaattattgca
agaaaaaattcagatcttgcaaatgatcttggtaatctctacagccgctctacagcaatg
ctgtttaagtacaccgacggtgtggtgccgctgccagtgagtgccgatgatgataacgtt
ctttcggatcttgcggaaaaagttttttccacatatcgggaggccatgaatacttttcag
tttcaccgtggtctccaggcaatatgggagctgatcagtcaggccaataaatatattgta
acaaatgagccatggactcttgtcaaagatccggggcagattggtcgtctgcatactgtg
ctgtataatcttgcagaaaccctgcgtatactcactctgcttcttcagccggtgatgcct
ggaacctgtaaaaaaatggcagaaggtctcggacttgaagaagacagtgcgttaatccag
gatttgatgctaaacggtggctgggggaaacttgagccgaagactgtgttgcagaaaagt
gatgcgctttttccgcgggttgatacaaaaaagaagcaacagcatctggagcaggaatcc
caaaagaatacaaagaaggcagcaaagaaaaagcagcaggaggaaaaaaccgagggagta
attagctttgaccagtttcagaaggttgaattacgggtggctgaaattgtgactgccgaa
gccgttaagaagtctgatcgcttgttaaaactcacggttagagcccctgaagagcgggtt
atcgtagctgggatcgcggaattttatcaaccggaggatcttccaggtatgcaggtactg
attgtggcaaacctgcagcctgtgaagcttatgggtgtggaatcccaggggatggtactt
gcggcaaagacagaggtggatggtaaaaatcgcctggtgctttccgcggtaagtgcacca
gttccgccgggctcacgtgtcgcctga

DBGET integrated database retrieval system