KEGG   Desulfocapsa sulfexigens: UWK_02052Help
Entry
UWK_02052         CDS       T02473                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    UWK_02052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dsf03011]
    UWK_02052
Ribosome [BR:dsf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    UWK_02052
  Bacteria
    UWK_02052
  Archaea
    UWK_02052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGF78596
UniProt: M1PQC4
Position
2317957..2318289
Genome map
AA seq 110 aa AA seqDB search
MEARAVGRRIRISPQKARLVADVVRGMGVDKAITTLRFMPKKGASILRKVIESAVANATQ
DDQIDVDNLYVKTVFIDGGPSFKRIRPRAMGRATSIIKRTSHITVVLDEN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcgtgccgtagggagacgtattaggatctcccctcagaaagctagactcgtt
gctgacgtggttcggggaatgggcgttgataaagcgattaccactctcaggttcatgcca
aaaaaaggtgcgtcaatattgagaaaggtcatcgaatccgccgttgccaatgcaacccag
gacgaccagattgatgttgataatctttatgtaaaaactgtattcattgacggtggacct
tcttttaaaagaatccgaccccgcgcaatgggacgggcgacatcaattattaaacgtaca
agtcatataacagtagtgcttgatgaaaattaa

DBGET integrated database retrieval system