KEGG   Desulfocapsa sulfexigens: UWK_02513Help
Entry
UWK_02513         CDS       T02473                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00520  Amino sugar and nucleotide sugar metabolism
dsf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UWK_02513
Enzymes [BR:dsf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     UWK_02513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 NAD_binding_4 KR adh_short Methyltransf_31 adh_short_C2 NmrA
Motif
Other DBs
NCBI-ProteinID: AGF79049
UniProt: M1NHG8
Position
2800321..2801358
Genome map
AA seq 345 aa AA seqDB search
MTDGKKEMPMKKILVTGTAGFIGSFLARTLRESGCEVIGIDTITDYYDVGLKKDRLAKIA
GGEGFQNLEVDISDRGAMEKLFTDHSFDAVVNLAAQPGVRYSLINPASYIDTNIVGFANL
LEGCRHSGVKHFVYASSSSVYGANTHQPYSEHDNVNHPVSLYAASKKSNELMAHSYSHLF
GLPCTGLRFFTVYGPWGRPDMAPMLFARAILAGEPINVFNNGNMERDFTFIDDIVEGVAR
VIQKPAAPDFEWKSEAPDPATSYCPYRVYNIGNNRKERLLYFIQLLEENLGKKADKNFLP
MQPGDVQATYANVDDLIRDFDYKPDTPLDVGVKRFVDWYLDYYKQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgactgatggaaaaaaagaaatgccaatgaaaaagatactggtaacaggaacggctggc
tttatcggttcttttctggcacgtaccctgcgtgaatcgggttgtgaagtgattggaatt
gatacaatcaccgattattacgatgtgggtttgaaaaaagatcgtttggcgaagattgca
gggggggaagggttccagaatctggaggttgatatctcggatcgcggggccatggagaaa
ctgtttacagatcatagctttgatgcggtggtgaacctggccgcccagccgggggttcgc
tactcgctcatcaaccctgcgtcctatattgataccaatattgtcggttttgccaatctt
cttgaaggctgccgccattcaggggtgaaacattttgtctatgcctcttcaagttcggtt
tatggggcaaacacccatcagccctactcagaacatgataatgtcaatcatcccgtatct
ctctacgcagcatcaaaaaagtccaatgaactgatggctcactcctatagtcatcttttt
ggtcttccctgcaccgggctgaggttctttacagtgtacggcccctggggacgacctgat
atggctcccatgctttttgccagggctattctggccggagagccaatcaatgtctttaat
aatgggaatatggagcgtgattttacctttattgacgacatcgttgaaggggtggcccga
gtgatccagaaacctgcagcaccggattttgaatggaagagtgaggcgcctgaccctgcc
acgtcatactgcccctatcgcgtctataatataggcaataacaggaaagagcgtctcctc
tattttatccagcttcttgaggaaaatcttggcaaaaaagcagataagaattttcttccc
atgcagccgggagatgtgcaggcaacctatgccaatgtagatgatctgatcagggacttc
gattataagcctgatacccctctggatgttggggtgaagcgttttgttgactggtatctg
gactactacaagcagtaa

DBGET integrated database retrieval system