KEGG   Desulfocapsa sulfexigens: UWK_02632Help
Entry
UWK_02632         CDS       T02473                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsf01100  Metabolic pathways
dsf01110  Biosynthesis of secondary metabolites
dsf01130  Biosynthesis of antibiotics
dsf01230  Biosynthesis of amino acids
Module
dsf_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UWK_02632
Enzymes [BR:dsf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     UWK_02632
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     UWK_02632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: AGF79168
UniProt: M1P6S9
Position
complement(2926685..2927773)
Genome map
AA seq 362 aa AA seqDB search
MAKDLTPVRDGIDKIDNTILELLKERLSLAKSIGQLKDESKRAKWDPLRERQIYERLTKL
NDGVFPDNSLHSIFHEIITTCRLSQQKIAVAYLGPEATFTHLAGVKYFGQSATYSPMESI
ADVFSEVEKGRTQYGIVPVENSIEGAVFSTLDSFMQYRTKICGEVRMEITHNLVCKSGDI
SDIQTVASHTQPLAQCREWLRKHLPSCPTLPVFSTGAAAQMAANNPNIGAIASSLAIKTY
DLQVVVRGIEDYRGNTTRFLVIGKESPSPSGADRTSLLLGIMERPGALNEILSVIARAGI
NLAKIESRPIKGKQWKYLFFLDLMGHIEDEHIKDCCKTLNSLCSYYEWLGSYPQADESSS
DA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatctcacaccggttcgcgatggaatagacaagattgacaatactattctt
gagctcctcaaagaacgtctttcccttgccaagtccattggccagctaaaagatgaaagt
aagcgtgccaaatgggaccctctgcgcgagaggcagatttatgaacgcctgacaaagctt
aatgatggagtatttccagacaattcgcttcactcaatcttccatgaaatcatcaccaca
tgcagactttcccagcagaagattgcagtagcatatcttggccccgaggcaaccttcacc
catctggctggggtgaaatactttggccaatcagccacatacagcccaatggaatccatc
gctgatgttttttcggaggtggaaaaaggtcgaactcagtacggaatcgttcccgttgaa
aactccatcgagggtgccgttttttcaacgcttgattcctttatgcaatacagaaccaaa
atttgtggtgaagtgcggatggaaataacccacaatcttgtctgcaaatctggagatatc
agcgatatccagacagtggcatcccatacccagccacttgcccaatgtcgggaatggctg
cgtaaacacctaccgtcctgccccacccttcctgttttttcgaccggtgcggcagctcag
atggcagcaaacaatcctaatatcggggcaatagcctcttctctcgctatcaagacctac
gacctgcaggtggtggtaagagggattgaagactaccggggtaacacaacacgctttctg
gttattggaaaagagtctccatcaccaagcggtgctgacagaacatccctgctcctggga
attatggagcgtccgggtgccttaaacgagattttaagtgttattgcccgcgctggtatc
aacctggcaaagattgaatccagaccaatcaagggaaaacagtggaaatacctcttcttc
cttgacctgatgggtcatattgaagatgaacatatcaaggattgctgcaaaacccttaac
tcactctgctcatattatgaatggcttggttcctatccgcaggcggacgaatcatcctcc
gatgcgtga

DBGET integrated database retrieval system