KEGG   Desulfocapsa sulfexigens: UWK_02875Help
Entry
UWK_02875         CDS       T02473                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00260  Glycine, serine and threonine metabolism
dsf01100  Metabolic pathways
dsf01110  Biosynthesis of secondary metabolites
dsf01120  Microbial metabolism in diverse environments
dsf01130  Biosynthesis of antibiotics
dsf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UWK_02875
Enzymes [BR:dsf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     UWK_02875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGF79406
UniProt: M1PSW2
Position
complement(3205376..3206449)
Genome map
AA seq 357 aa AA seqDB search
MQFGSDNQAGASQPVLDALLEANHGFTHGYGNDNWCEKAEDALMDVFGCKLDVFFVATGT
AANALALSCMVQPWETILCHHHSHILLDESTAPEFFSGGSRLIPLTQHAGKLEIRHLKKF
FRNVSPEIPHTPSAKALSITQTNEAGQVYTEVEISSLCSLAHENGLHVHMDGARFANAVA
SLGCTFADISWKAGVDVLSLGATKCGALAAEAVVFFRQDLAENFIHRRKRSGHLLSKGRL
FGAQFVGWLKNNHWLELATHANAKAQQLARALKVFQEIVPVWPCQANEIFITMPRQLAER
LQAEGAEFYQWPIQTLPNNYTLRDEDVFVRLVTSFATSDEHIRDFCDRINEFKASAP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttggaagtgacaatcaagccggggcatctcagcctgtacttgacgcattgtta
gaggcaaaccatggatttacccacggctacggaaatgacaattggtgcgaaaaagcagaa
gatgctttaatggatgtatttggctgtaaacttgatgttttttttgtggcaaccgggaca
gcagcgaacgctcttgccctctcttgtatggtacaaccttgggaaaccatcctttgccac
caccattctcatattctacttgatgaatccacggcccctgaatttttctcaggaggtagc
cgtcttattcctttgacacaacatgccggaaaactggaaatcagacatttgaaaaaattc
tttcgaaatgtttcccctgagatcccacacacaccctctgccaaagccctaagtatcact
caaacaaatgaggcagggcaagtgtacactgaggtggaaatctcatccctttgttccctt
gcccatgaaaacggtcttcatgtccatatggatggggcacgctttgccaatgctgtggcc
tctcttggatgtacatttgcggatataagctggaaagccggcgttgatgtccttagcctt
ggtgcaacaaaatgcggagcccttgctgctgaagcagttgttttcttcaggcaggacctt
gcagagaattttatccatcgtagaaaacgatcgggacaccttctttcaaaaggccgtttg
tttggtgcccaatttgttggctggttgaagaacaaccattggctggagctggccacacat
gccaacgccaaggcacagcaattagccagggcactaaaagtttttcaggaaatagttcct
gtctggccatgccaggcaaacgaaatttttattaccatgcccagacaattggctgaaaga
ctgcaggcagaaggtgccgaattttaccaatggcccatccaaactctgccgaacaactat
actctcagggacgaagatgtctttgtacggctggtgacatcctttgcaaccagcgacgaa
cacatcagggatttttgtgatcgtattaatgaatttaaagcatcagcaccttaa

DBGET integrated database retrieval system