KEGG   Dinoroseobacter shibae: Dshi_0659Help
Entry
Dshi_0659         CDS       T00612                                 

Gene name
hemN2
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00860  Porphyrin and chlorophyll metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dshi_0659 (hemN2)
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Dshi_0659 (hemN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABV92405
RoseoBase: Dshi_0659
UniProt: A8LQB9
Position
complement(662948..664309)
Genome map
AA seq 453 aa AA seqDB search
MTPKTQLARYGLFDTRVPRYTSYPTATHFSQATRPRDFTAWIQAIPPGSEISLYAHVPFC
RRLCWFCACRTQGTQSDAPVRAYVDTLLAEIALLRAALPEGVRLSRIHWGGGTPTLLAPD
LVTRLAEAMFALAPTTDRAEFSVEIDPNEIDAARLDALAAAGMNRASIGVQDFDPDIQKA
IGREQRFEVTEAVVMDLRDRGIRSLNTDILYGLPFQTPVKITESVQKLLSLQPDRVALYG
YAHVPWMARRQNLIPNEALPTPEARLDLFETARRLFRWDNYAEIGIDHFAHQGDGLAVAA
AERRLHRNFQGYTDDSATVLIGLGASAISRFPQGYAQNASGTAQYQKAIRAGGFATVRGH
DFAGDDAMRARMIEMIMCDFAVDGRELVRVFKVPEARITALFRAAQEQFGGMVELDSGAL
SFRIPPDARPLTRMIARAFDRYEAPAGSHSVAT
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaaaacgcaacttgcgcgctacgggctttttgacactcgcgttccacggtac
acgagctatcccacggcgacccatttctcgcaggccacccggccaagggatttcacggcc
tggatccaggcgatccccccggggagcgagatttccctctacgcgcatgtgccgttttgt
cgccgcctgtgctggttctgcgcctgccgcacccaaggcacccagagcgacgcgccggtg
cgcgcctatgtcgataccctgctggctgaaatcgccctgctgcgcgcggcgctgcccgaa
ggtgtccgcctgtcgcgcatccattgggggggcggcacaccgaccctgctcgcgccggac
ctggtgacgcggctggccgaggcgatgttcgccctggcgcccaccaccgaccgggcggaa
ttctcggtcgagatcgacccgaacgagatcgacgccgcccgcctcgacgcgctggccgcc
gcgggcatgaaccgcgcctcgatcggggtgcaggatttcgacccggacatccagaaggcg
atcggacgcgaacagcgattcgaagtgaccgaggcggtggtgatggacctgcgcgaccgc
ggcatccgaagcctgaacaccgacatcctttatggcctgcccttccagacaccggtgaag
atcaccgagtcggtacagaagctgctgtcgctgcaaccggaccgggtcgccctctatggc
tacgcccatgtgccctggatggcccggcgccagaacctgatcccgaacgaggcgctgccc
accccggaggcccggctcgacctgttcgaaaccgcccgccgcctgttccgctgggacaac
tacgccgagatcggtatcgaccatttcgcgcaccagggagacgggctcgccgtggccgcc
gccgaacggcgcctgcatcggaatttccagggctacacggacgattccgcaaccgttctg
atcggcctcggcgcctcggcgatctcgcgcttcccgcaaggctacgcccagaacgccagc
ggcaccgcccagtaccagaaggccatccgcgcaggcggcttcgccacggtgcggggccac
gactttgccggggacgatgcgatgcgggcgcgaatgatcgagatgatcatgtgcgatttc
gccgtggatggccgggaactggtccgcgtgttcaaggtgcccgaggcccggatcaccgcc
ctgttccgcgccgcacaagagcaattcggcggtatggtcgagctcgacagcggggcactc
agcttccgtatcccccccgatgcacgccccctgacccggatgattgcaagggccttcgac
cgctacgaggccccggcaggcagccactcggtcgccacctga

DBGET integrated database retrieval system