KEGG   Dinoroseobacter shibae: Dshi_0931Help
Entry
Dshi_0931         CDS       T00612                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00010  Glycolysis / Gluconeogenesis
dsh00071  Fatty acid degradation
dsh00350  Tyrosine metabolism
dsh00625  Chloroalkane and chloroalkene degradation
dsh00626  Naphthalene degradation
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_0931 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Dshi_0931 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dshi_0931 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dshi_0931 (adhA)
   00626 Naphthalene degradation
    Dshi_0931 (adhA)
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dshi_0931 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C TrkA_N AlaDh_PNT_C FeoA
Motif
Other DBs
NCBI-ProteinID: ABV92676
RoseoBase: Dshi_0931
UniProt: A8LRW9
Position
complement(955308..956327)
Genome map
AA seq 339 aa AA seqDB search
MSMMKAALVTDFSKPLEIREVRKPTVTDGNILVKIEACGVCHTDLHAARGDWPVKPEPPF
IPGHEGVGVVVEVGHNVTSVKEGDRVGVPWLHHACGHCTACVTGWETLCRTEPEYTGYTV
NGGFAEYVEADPTYVGHLPDKLDFAPAAPILCAGVTVYKGLKECDLHPGQTVVISGIGGL
GHLAVQYARAMGLHVIAVDVAEDKLALARDLGAGVAINAATQDPVAEVARLGGAEGVLVT
AVSNTAFSQGVGMLAPGGTMSLVGLPPGDFPLNIFDVVLNRKTIRGSIVGTRADLAESLS
FAAEGKVASHYATDSLDNINGIFDQMEQGRIEGRIVMTM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgatgaaggccgctctcgtcaccgatttctcgaagccgctggagatccgtgaa
gtccggaaaccgaccgtcacggacggcaatatcttggtgaaaatagaggcttgcggggtc
tgccacaccgatctgcacgcggcgcgcggcgactggccggtcaagcccgagccacccttc
attccgggccacgaaggcgtgggcgtggtggtcgaggtcgggcacaatgtcacgtcggtc
aaggaaggcgaccgggtgggcgtgccttggctgcatcacgcctgcgggcattgcaccgcc
tgtgtcacgggctgggagacgctctgccggacggagccggaatacaccggctacacggtc
aatggcgggttcgcggagtatgtggaagcggatccgacctatgtcggacatctgcccgac
aagctcgatttcgcacctgctgcccccatcctgtgcgccggtgtgacggtctacaagggg
ctgaaggaatgcgacctgcatccaggccagaccgtcgtgatttccggcatcggcggactt
gggcaccttgcagtgcagtacgcgcgcgcgatgggtctgcatgtgatcgccgtcgacgtg
gccgaggacaagctcgccttggcccgcgacctcggcgcgggcgttgccatcaacgccgcg
acgcaggacccggtggccgaggtcgcgcggcttggcggggccgagggcgtccttgttacg
gccgtctcgaacaccgcgttctcacagggcgtggggatgctcgcacccggcggaacgatg
agcctcgtcggtcttccgccaggcgactttcctttgaacatcttcgacgtggtcctcaac
cgcaagacgatccgtggctccatcgtcggcacgcgcgccgacctcgccgagagcctctcc
ttcgcggccgagggaaaggtcgcctcgcattacgcaaccgacagcctcgacaatatcaac
ggcatcttcgaccagatggaacagggccggatcgagggccggatcgtgatgacgatgtga

DBGET integrated database retrieval system