KEGG   Dinoroseobacter shibae: Dshi_1136Help
Entry
Dshi_1136         CDS       T00612                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, A subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00072  Synthesis and degradation of ketone bodies
dsh00280  Valine, leucine and isoleucine degradation
dsh00650  Butanoate metabolism
dsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dshi_1136
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dshi_1136
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dshi_1136
Enzymes [BR:dsh01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Dshi_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABV92878
RoseoBase: Dshi_1136
UniProt: A8LHT1
Position
complement(1161319..1162014)
Genome map
AA seq 231 aa AA seqDB search
MQKIYGSAAEALEGLLFDDMLIAAGGFGLCGIPELLIEAVQKSGVKRLTIASNNAGVDDF
GLGLLLQTKQVKKMMSSYVGENDLFMQQYLSGELEIEFNPQGTLAERMRAGGCGIPGFYT
KTGVGTVIAEGKEHKDFNGETYILEEGIFADLSIVKAWKADETGNLVFRKTARNFNPPAA
MCGKVCVAEVEEIVPTGTLDPDTIHLPGIYVHRLVQGEHEKRIEQRTTRAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaatctatggctcggccgccgaggcgcttgaggggctcttgttcgatgacatg
ctgatcgcggcgggagggttcggcctgtgtggcattcccgagctgctgatcgaagcggtc
cagaaaagcggcgtcaagcgtctgaccatcgccagcaacaacgctggggtggatgatttc
ggcctcgggctcctgctgcagaccaagcaggtcaagaagatgatgtcgtcttatgtcggc
gagaacgacctgttcatgcagcagtacctgtcgggcgagttggagatcgagttcaacccc
cagggcaccctggccgagcggatgcgcgcgggtggttgcgggattccgggcttctacaca
aagaccggcgtgggcaccgtgattgccgagggcaaggagcacaaggacttcaacggcgag
acctatatcctcgaagaagggatcttcgccgacctgtccattgtgaaggcctggaaggcg
gacgagaccggcaacctcgtgttccgcaagaccgctcggaatttcaacccgcccgccgcg
atgtgtggcaaggtctgcgtcgccgaggtggaggagatcgttccgaccggcacactggac
ccggataccatccatctgcccggcatctatgtgcaccgcctcgtccagggggagcacgaa
aaacggatcgagcagcggacgacacgcgccgcctga

DBGET integrated database retrieval system