KEGG   Dinoroseobacter shibae: Dshi_1289Help
Entry
Dshi_1289         CDS       T00612                                 

Definition
(GenBank) glutamine amidotransferase class-I
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00230  Purine metabolism
dsh01100  Metabolic pathways
Module
dsh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dshi_1289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dsh01002]
    Dshi_1289
Enzymes [BR:dsh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     Dshi_1289
Peptidases and inhibitors [BR:dsh01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   Dshi_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ABV93031
RoseoBase: Dshi_1289
UniProt: A8LIR7
Position
1342529..1343269
Genome map
AA seq 246 aa AA seqDB search
MKPFLILQLRPEPEVSDDEYAAILTKSGLRAQDTQRICLDHEKLPDELDLADYSGVIVGG
GPGCISDPAEVKTPTEARIEAAILSLMPEVVGRDVPFMGCCYGMGALGHHLGAEVSKRRY
GEGVAAVPCERTEAGRADPILADLPDRFDAFVGHKEALQDLPKGAVHLMRGEACPFQMIR
YGQNVYATQFHPEADGDGVALRIRAYRDKGYFPPEEAEPLIARVQHADVRASARILRNFV
ARYATG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtttctgatcctgcaactgcgccccgaaccggaggtgtccgacgacgagtat
gccgcgatcctgaccaagtcgggcctgcgcgcgcaggacacgcagcggatctgtctcgat
cacgagaaactgcccgatgagcttgatctcgcggattattccggcgtgatcgtcggcggc
gggccgggctgtatcagcgaccccgcagaggtgaaaacaccgaccgaggcgcggatcgag
gcggcgatcctgtcgctcatgcccgaggtggtgggccgcgacgtgccgttcatgggctgc
tgctacggcatgggtgcgctcgggcatcacctgggtgcggaggtctccaagcgccgctat
ggcgagggcgtcgccgcggtgccctgcgaacgcaccgaggccgggcgcgccgatccgatc
ctcgccgacctgccggaccggttcgacgccttcgtcggccacaaggaggcgttgcaggac
ctgcccaagggggccgtgcacctgatgcgcggcgaggcgtgcccgttccagatgatccgc
tacgggcaaaatgtctacgcgacccagttccaccccgaagccgatggcgacggcgtggcc
ctgcgcatccgcgcctatcgcgacaaggggtatttcccgcccgaagaggccgagcccctc
atcgcgcgggtccagcatgcggatgtgcgcgcaagtgcccgtattctcaggaatttcgtg
gcccgatacgcaaccggttga

DBGET integrated database retrieval system