KEGG   Dinoroseobacter shibae: Dshi_1821Help
Entry
Dshi_1821         CDS       T00612                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
dsh  Dinoroseobacter shibae
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dsh01003]
    Dshi_1821
Enzymes [BR:dsh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     Dshi_1821
Glycosyltransferases [BR:dsh01003]
 Others
  Glycosylglycerate
   Dshi_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABV93563
RoseoBase: Dshi_1821
UniProt: A8LML8
Position
1898926..1900176
Genome map
AA seq 416 aa AA seqDB search
MHEAGATGVADFHQNGNITTLHNLRTRSVEELTQELKAYSVSRKISLILPSLYSELEGPA
LPRILDELSEVPYLHRIIIGLDRADEAQYRHARDFFGRLPQDHIVIWNDSPRMTGLGRRL
ETMGLAPQEAGKGKNVWSCLGYLMACQDSAVMAIHDCDILTYDRDMLARLVYPVVNPNFP
YQVAKGYYPRIGENRINGRVTRLLVSPLLIALKRVIGDRDYIDYLRSFRYPLSGEFAMRT
GILPDLRIPSDWGLEIGVLSEAWRNLAPKAVCQVEISDAYDHKHQDLSEDDASAGLSRMS
TDICKSIFRKLAMDGTVFTTHVFRTLKATYYRSALDLLEAYYSDAMMNGLAIDRHREEQS
IELFAENIMRAGQIFLDNPSETPFIPTWNRVHAADPDFLSDFRRAAAEDVAEYGAG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgaagcaggagcgaccggcgtggcggattttcatcagaacgggaacatcacgacg
ctgcacaatctgcggacgcgttcggtcgaggagctgacgcaggagctcaaggcctattcc
gtcagccgcaagatcagcctgatcctgccctcgctctactcggagttggaagggcccgcc
ctgccccggatcctggatgagctgagcgaggtgccctatctgcaccggatcatcatcggg
ctcgaccgggccgacgaggcgcagtaccgccatgcgcgggatttcttcgggcggctgccg
caggaccatatcgtcatctggaacgacagcccccggatgacggggttgggccggcggctg
gagaccatggggctggcgccgcaggaggccggcaagggcaagaacgtctggtcctgcctg
ggctacctgatggcgtgtcaggacagcgcggtcatggcgatccacgattgcgacatcctg
acctatgaccgggacatgctggcgcggctggtctatccggtggtgaacccgaacttcccc
taccaggtcgccaagggctactacccgcggatcggcgagaacaggatcaacgggcgggtc
acgcggctgctggtcagcccgctgctgatcgcgctgaaacgggtgatcggggatcgcgac
tatatcgattacctgcgcagcttccgctatcccctgtcgggggagttcgccatgcgcacg
ggcatcctgccggacctgcgcatcccgtcggactgggggctggagatcggggttctgtcg
gaggcctggcgcaacctcgcgcccaaggcggtctgccaggtggagatcagcgacgcctac
gaccacaagcaccaggatctgagcgaggatgacgcctcggcggggctgagccggatgtcc
acggatatctgcaagtcgatcttccgcaagctggcgatggatggcacggtgttcaccacc
catgtgttccgcaccctgaaggcgacctattaccgctcggcgctcgaccttttggaggcg
tattactcggacgcgatgatgaacgggctggccatcgaccggcaccgggaggagcagtcg
atcgagctctttgcggagaacatcatgcgggcgggacagatcttcctcgacaacccgtcg
gagacgccgttcatcccgacctggaaccgggtgcatgcggcggatccggatttcctgagc
gatttccgcagggccgccgccgaggacgtggcggaatacggggcgggctga

DBGET integrated database retrieval system