KEGG   Dinoroseobacter shibae: Dshi_2672Help
Entry
Dshi_2672         CDS       T00612                                 

Definition
(GenBank) hypothetical protein
  KO
K08738  cytochrome c
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dshi_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ABV94405
RoseoBase: Dshi_2672
UniProt: A8LIG4
Position
2828064..2828483
Genome map
AA seq 139 aa AA seqDB search
MTRILTAAALGLTMLAPAAQAGPATFEQVKIDAGAALYEAECRRCHAPDSDHESYGPPLN
NIVGRAAGIVEDYDYSIALEASGIVWTPAALRAWMEDNDGFMPGTKMRHVGIEDRTVQDF
IIAYLTSISDVEMNQSLDK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaatactcaccgccgcagccctgggcctgacgatgctggcaccggctgcgcag
gcaggtccggcaacattcgaacaagtcaagatcgacgcgggcgcggcgctctacgaggcc
gagtgccgccgctgccatgccccggacagcgaccatgaaagctatggtcccccgctgaac
aatatcgtggggcgcgcggccgggatcgtcgaggattacgactattccatcgcgctcgaa
gcctcgggcatcgtctggaccccggccgccctgcgcgcctggatggaagacaatgacggc
ttcatgcccggcaccaagatgcgccatgtgggcatcgaggaccgcaccgtgcaggatttc
atcatcgcctatctgaccagcatctccgatgtcgagatgaaccagtcgctggacaagtag

DBGET integrated database retrieval system