KEGG   Dinoroseobacter shibae: Dshi_2700Help
Entry
Dshi_2700         CDS       T00612                                 

Gene name
dhlB
Definition
(GenBank) (S)-2-haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00361  Chlorocyclohexane and chlorobenzene degradation
dsh00625  Chloroalkane and chloroalkene degradation
dsh01100  Metabolic pathways
dsh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dshi_2700 (dhlB)
   00361 Chlorocyclohexane and chlorobenzene degradation
    Dshi_2700 (dhlB)
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Dshi_2700 (dhlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ABV94433
RoseoBase: Dshi_2700
UniProt: A8LIJ2
Position
2860992..2861681
Genome map
AA seq 229 aa AA seqDB search
MPITTCIFDAYGTLFDVSAAAREAAAEPGRAAFATRWPQIARDWRLKQLQYTWLRAITGD
HCDFWQVTQDGLDWALEAAGLGDDAELRERLLQLYWELSAYPEVPAMLGALKDQGLNTGI
LSNGAPDMLAGAVDSAGIGALLDDVLSVESVSIFKPARLVYDLVGARFGCSPEQVMFVSS
NGWDAAAAAAYGFRAVWANRAEEPVDRLPAVPDRIVADLRPLPVLVKEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaccacctgcattttcgacgcctatggcaccctgttcgatgtcagcgccgcc
gcccgcgaagccgccgcggagcccgggcgcgccgccttcgccacccgctggccgcagatc
gcgcgggactggcggctcaagcaactgcaatacacctggctccgcgccatcaccggggac
cattgcgatttctggcaggtcacgcaggacggcctcgactgggcgctggaggccgcgggc
ctcggcgacgatgcggagctgcgcgaacgcctgctgcagctctactgggagctgtcggcc
tacccggaggtgcccgccatgctcggcgcgctcaaggaccagggcctgaacacgggcatc
ctgtccaatggcgcgccggacatgctcgcaggcgcggtggacagcgccgggatcggggcg
ctgctcgacgatgtgctcagcgtcgaatcggtcagcatcttcaagcccgcgcggctggtc
tatgacctcgtcggcgcgcgcttcggctgcagcccggagcaggtgatgttcgtctcctcc
aacggctgggacgcggcggcggccgccgcctacgggttccgcgcggtctgggccaaccgc
gccgaagagcccgtcgaccgcctgcccgcggtgcccgaccggatcgtcgccgacctccgc
ccgcttcccgtcctcgtgaaagagctctga

DBGET integrated database retrieval system