KEGG   Dinoroseobacter shibae: Dshi_2800Help
Entry
Dshi_2800         CDS       T00612                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dshi_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ABV94533
RoseoBase: Dshi_2800
UniProt: A8LJ38
Position
complement(2958766..2959473)
Genome map
AA seq 235 aa AA seqDB search
MQGKLTPLLWAAALVGLTGAAPADEIGDPERGAQLFRQCASCHQIGDGAESRVGPHLNEI
YGRRAGSIERFSYSDGMLRMGADGLIWDLRTLDAYIANPRALVSGTRMSYRGMPEAQDRA
DLLAYMRDFTASPADIPEAEPTALPSVPELPPDVLALQGDAEWGAYLSSECTSCHQIDGT
DQGIPSITYWPEEDFVLALHAYKTKLRPHPVMQMIAGRLSNEEIAALAAFFKDPD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtaagctgacacccctgctgtgggcggcggcgctggtcgggctgaccggtgcc
gcccccgcggacgaaatcggtgacccggagcgcggcgcgcaactctttcgccaatgcgca
agctgccaccagatcggcgacggcgccgaaagccgggtgggccctcacctgaacgagatc
tacggtcgccgcgccggcagcatcgaacggttcagctattccgacgggatgctgcgcatg
ggggcggacgggctgatctgggatctgcgcacgctcgacgcctatatcgccaacccccgc
gcgctggtatcgggcacccggatgagctaccgcggcatgccggaggcgcaggaccgcgcc
gaccttctggcttacatgcgcgacttcaccgccagtcccgccgacatccccgaggccgaa
ccgacagccctgccgtcggtgcccgagttgccgccggatgtgctggcgctgcaaggggat
gcggagtggggggcctatctttcgtccgaatgcacctcctgtcaccagattgacgggaca
gatcagggaattccctccattacctattggccggaagaggattttgtgctcgcattgcac
gcatacaagaccaagctgcgcccgcatccggtcatgcagatgatcgccggccggttgagc
aacgaggagattgccgcgctcgcagcctttttcaaggatcctgactag

DBGET integrated database retrieval system