KEGG   Dinoroseobacter shibae: Dshi_3066Help
Entry
Dshi_3066         CDS       T00612                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00071  Fatty acid degradation
dsh00072  Synthesis and degradation of ketone bodies
dsh00280  Valine, leucine and isoleucine degradation
dsh00310  Lysine degradation
dsh00362  Benzoate degradation
dsh00380  Tryptophan metabolism
dsh00620  Pyruvate metabolism
dsh00630  Glyoxylate and dicarboxylate metabolism
dsh00640  Propanoate metabolism
dsh00650  Butanoate metabolism
dsh00900  Terpenoid backbone biosynthesis
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
dsh01212  Fatty acid metabolism
dsh02020  Two-component system
Module
dsh_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dshi_3066 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Dshi_3066 (atoB)
   00640 Propanoate metabolism
    Dshi_3066 (atoB)
   00650 Butanoate metabolism
    Dshi_3066 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dshi_3066 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Dshi_3066 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dshi_3066 (atoB)
   00310 Lysine degradation
    Dshi_3066 (atoB)
   00380 Tryptophan metabolism
    Dshi_3066 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dshi_3066 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dshi_3066 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dshi_3066 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsh04147]
    Dshi_3066 (atoB)
Enzymes [BR:dsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dshi_3066 (atoB)
Exosome [BR:dsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dshi_3066 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABV94799
RoseoBase: Dshi_3066
UniProt: A8LL50
Position
3234503..3235678
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFGGSFANTPAHDLGSAVLEALVARAGIEKGEVSETILGQVLTGG
QGQNPARQAHINAGLPQESAAWGLNQVCGSGLRAVALGAQHIQLGDAEIVCAGGQENMTL
SPHVANLRAGQKMGDMKFIDSMIRDGLWDAFNGYHMGQTAENVAEKWQISREMQDEFAVA
SQNKAEAAQKAGKFDDEVVAFTIKTRKGDIVVDKDEYIRHGATMEAMQKLRPAFTKDGSV
TAANASGLNDGAAGVLLMSAENAEKRGITPMARIASYATAGLDPSIMGVGPIYASRKALE
KAGWKVDDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNGGAIAIGHPIGASGARVLNTL
LFEMQRRDAKKGLATLCIGGGMGVALCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgtcgtaatcgcatccgccgcgcgtactgccgtcggcagcttcggcggatcc
tttgccaacacgcctgcccatgacctgggctccgccgtgctcgaagcgctggtagcgcgc
gcggggatcgagaagggagaagtctccgagaccatcctcggccaggtgttgaccggcggc
cagggccagaacccggcgcgccaggcgcatatcaacgcaggcctgccgcaggaaagcgcg
gcctggggtctcaaccaggtgtgcggctcgggcctgcgcgcggtcgccctcggcgcccag
cacatccagctcggcgatgcggagatcgtctgcgccggcggccaggaaaacatgacgctc
agcccccatgtggccaacctgcgcgcgggccagaagatgggcgacatgaagttcatcgac
tcgatgatccgcgacggcctctgggacgcgttcaacggctaccacatgggccagaccgcc
gaaaacgtcgccgagaagtggcagatcagccgcgagatgcaggacgagttcgccgtcgcc
agccagaacaaggccgaggccgcccagaaggcgggcaagttcgatgacgaggtggtggcc
ttcaccatcaagacccgcaagggcgacatcgtcgtggacaaggacgagtacatccgccac
ggcgcgaccatggaggccatgcagaaactgcgcccggccttcaccaaggacggctcggtc
acggcggccaatgcgtcggggctgaacgacggcgcggccggcgttctgctgatgtcggcg
gaaaatgccgagaagcgcgggatcaccccgatggcgcgcatcgcgtcctacgccaccgcc
gggctcgacccgtcgatcatgggcgtcgggccgatctatgcctcgcgcaaggcgctggag
aaggccgggtggaaggtcgacgacctggacctggtggaagccaacgaagccttcgccgcc
caggcctgtgccgtgaacaaggacatgggctgggatccggcgatcgtgaacgtgaacggc
ggcgcaatcgccatcggtcacccgatcggcgcctccggcgcgcgggttctcaacaccctg
ctgttcgaaatgcagcggcgggatgccaagaagggccttgccacgctgtgcatcggcggc
ggcatgggcgtggcgctctgcgtcgagcgcccctga

DBGET integrated database retrieval system