KEGG   Dinoroseobacter shibae: Dshi_3536Help
Entry
Dshi_3536         CDS       T00612                                 

Gene name
bchH
Definition
(GenBank) magnesium-chelatase subunit H
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00860  Porphyrin and chlorophyll metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dshi_3536 (bchH)
Enzymes [BR:dsh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Dshi_3536 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479 SAA
Motif
Other DBs
NCBI-ProteinID: ABV95269
RoseoBase: Dshi_3536
UniProt: A8LQ29
Position
3716986..3720570
Genome map
AA seq 1194 aa AA seqDB search
MLDNSTLPGTGLAPTPYRFVIITLDSHVLGPAARVNAALQKDFPGLQVSVHATGEWTENP
AALEATKAAIAEADIVVVNLIFLDDQIQAILPALRARRAACDAMVCVIADQMLVNLTKMG
DVDLSKPASGAMAILKKLKPKTKKTSSSEGQMKILRRLPKILRFLPGKAQDLRNYFLTMQ
YWLDGSDENTEEMLRMLISAYARRPGWSEVTAKPPIEYPEVGLFHPSHPARVFTDLAELP
GTAKPVATIGLLMMRSYILSRDSAHYEAVIDAFEARGVRVIPAFAGGLDGRPAIERYFRD
ARGATVDAMVSLTGFSLVGGPAYNDSAAAVEVLEDLDIPYIAAHPLEFQTLGQWAAAAGG
LGPVETTMLIALPEIDGATNPTVFAGRHGEDRCTGCQYRCQSPGNTKAMSPCLERIDVLA
EKAVRLASLRRKENAAKKVAVVLFGFPPNAGAVGTAAYLSVFESLFNTLARMKAEGYEVE
VPESVDALRAAVLQGNAKQYGQEANVAAHVSADHIVANTPPLAVIEDVWGPAPGKIQSDG
RGVFILGQHFGNVFVGVQPTFGYEGDPMRLLFERGFAPTHAFTQFYMWLRNTYAADVVLH
FGMHGALEFMPGKQAGLGARDWPDRLIGEMPNVYLYASNNPSEATLAKRRSNAVTVTHVT
PPLATSGLYKGLAELKDSMARYRGLAPDADERAELAALIAQQAEAVDMDGSNPDTLWLKL
LETEDALIPDGLHIVGRAPTEAEIEAHLDVMPDQSPETRARVADLLKQDGELQGLMKALS
GRYVSPVPGGDLIRSPEVLPAGRNIHAFDPFRMPTAFAMQDGARQAEVLLETHDTLPRSI
ALVLWGSDNIKSDGGPIAQALALMGARPRFDGYGRLCGAELISLAELGRPRIDVIMTLSG
IFRDLLPLQTKMLAEAAYLCAVADEPVEQNFVRAHALAYAAEMGCDMETAALRVFSNAEG
AYGSNVNALVDSSSFGEEDELADAYEARKSFAYGRSGKASANPELLQKTLRDVDIAYQNL
ESVELGVTTVDHYFDTLGGIARAVKRAKGGQEAAVYIGDQTRGSAKVRTLKEQVALETRS
RSLNPKWFESMLKHGHEGVRQIEAQVTNTMGWSATTGQVEPWVYQRLSETFVLDDEMRKR
LADLNPQASARMANRLIEAFERDYWQPDADTLAALQDAADEIEDALEGITIAAE
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataactcgaccctccccgggaccggcctcgcgccgaccccctaccggttcgtg
attatcacgttggacagtcacgtgctcggccctgccgcgcgggtgaatgcggccctgcaa
aaggacttcccgggcctgcaggtctcggtccacgccacaggcgaatggacggaaaacccc
gccgcgctcgaggccaccaaggccgccatcgccgaggccgatatcgtcgtcgtcaacctg
atcttcctcgacgaccagatccaggcgatcctgcccgccctgcgcgcccgccgcgcggcc
tgcgatgcaatggtctgcgtcatcgccgaccagatgctcgtcaacctcacgaagatgggc
gatgtggacctgtccaagcccgcttcgggcgccatggcgatcctcaagaaactcaagccc
aagaccaagaagacctcctcctccgaagggcagatgaagatcctgcgccgcctgcccaag
atcctgcggttcctgccgggcaaggcccaggacctgcgcaactacttcctgaccatgcaa
tactggctggacggctcggacgagaacaccgaggaaatgctgcggatgctgatctcggcc
tatgcccgccgcccgggctggtccgaggtcaccgccaaaccgccgatcgaatatcccgag
gtggggctcttccacccgtcgcatccggcccgcgtcttcaccgacctcgcggaactgccc
ggcaccgccaagccggtcgccaccatcggccttctgatgatgcgcagctacatcctcagc
cgcgacagcgcccattacgaggcggtgatcgacgcattcgaggcccgcggcgtgcgtgtc
atcccggccttcgcgggcgggctcgacggtcgcccggcgatcgaacggtatttccgcgac
gcccgcggggccaccgtggacgccatggtctcgctcaccggcttctccctcgtgggcggc
ccggcctataacgacagcgccgccgcggtcgaggtgctcgaagacctcgacatcccctat
atcgctgcccatccgctggaattccagacgctcggccagtgggccgccgccgcgggcggg
ctcggcccggtcgagaccaccatgctcatcgccctgcccgagatcgacggggccaccaac
cccacggtcttcgcgggccgccacggcgaggaccgctgcaccggctgtcagtaccgctgc
cagtccccgggcaacaccaaggcgatgtccccctgcctcgaacggatcgacgtgctggcg
gagaaggccgtgcgcctcgcctccctgcgccgcaaggaaaacgccgccaagaaggtcgcc
gtggtcctgttcggcttcccgcccaatgccggcgctgtcggaacggcggcttatctcagc
gtgttcgagagcctcttcaacaccctcgcccggatgaaggccgaaggctacgaggtcgag
gtgcccgagagcgtcgacgccctgcgcgccgccgtgctgcaaggcaacgccaagcaatac
gggcaggaggccaatgtcgccgcccatgtcagcgccgatcatatcgtcgccaataccccg
ccgctcgcggtgatcgaagacgtctggggccccgcccccggcaagatccagtccgacggg
cgcggcgtgttcatcctcggccagcatttcggcaatgtcttcgtgggcgtccagccgacc
ttcggctacgagggcgacccgatgcgcctgctgttcgagcgcggcttcgcgcccacccac
gccttcacccagttctacatgtggctgcgcaacacctatgccgccgacgtggtgctgcat
ttcggcatgcacggcgcgctggaattcatgccgggcaagcaggcgggcctcggtgcgcgc
gactggcccgaccggctgatcggcgagatgccgaatgtctatctctatgcctccaacaac
ccgtccgaggcgaccctggccaagcgccggtccaacgccgtgaccgtcacccatgtgacc
ccgccgctcgcgacatcgggtctctacaagggactggcggagctgaaggacagcatggcg
cgctaccggggcctcgcccccgatgccgacgaacgcgccgagcttgccgccctgatcgcc
cagcaggccgaggcggtggatatggacggcagcaaccccgacaccctctggctcaagctg
ctggagaccgaggatgccctgatccccgacgggctgcatatcgtgggccgcgcgcccacc
gaggccgagatcgaggcccatctcgacgtgatgcccgaccagtcgcccgagacccgggcg
cgggtcgccgatctgctgaagcaggatggcgagttgcagggcctgatgaaggcactgtcg
gggcgctatgtctcgccggtgcccggcggcgacctgatccgctcccccgaggtgctgccc
gcgggccgcaacatccacgcgttcgacccgttccgcatgcccaccgcttttgccatgcag
gacggcgcgcgccaggccgaggtgcttctggaaacccacgacaccctgccgcggtccatc
gcgctggtgctctggggttccgacaacatcaaatccgacggcggcccgatcgcccaggcg
ctggccctgatgggcgcgcggccccggttcgacggctacggccggctctgcggggccgaa
ctgatctcgctggccgaacttggccgcccgcgcatcgacgtgatcatgactctctcgggc
atcttccgcgatctgctgcccctgcaaaccaagatgctggccgaagccgcgtatctctgt
gctgtcgccgacgagccggtggagcagaacttcgtccgcgcccacgcgctggcctatgcc
gccgagatgggctgcgacatggaaaccgccgctttgcgggtcttttccaacgccgaaggg
gcctatggctccaacgtcaacgccctggtggacagctcctccttcggcgaagaggacgag
ctggccgatgcctacgaggcgcgcaagagcttcgcctatggccgctcgggcaaggcctcg
gccaatcccgaactgctgcaaaagaccctgcgcgacgtggacatcgcctaccagaacctc
gagtcggtcgagctgggcgtgaccacggtggatcactatttcgacacgctcggcggcatc
gcccgcgcggtcaagcgcgccaagggcgggcaggaggcggccgtctatatcggcgaccag
acccgcggctccgccaaggtgcgcaccctcaaggaacaggtcgcgctggaaacccggtcg
cggtccctgaaccccaaatggttcgaaagcatgctcaagcacggccacgaaggcgtgcgc
cagatcgaggcccaggtgaccaacaccatgggctggtcggccaccaccggccaggtcgag
ccctgggtctaccagcgcctgagcgagaccttcgtgctggacgacgagatgcgcaaacgg
ctggcggacctgaacccccaggccagcgcgcgcatggcgaaccgcctgatcgaggcgttc
gaacgggactactggcagccggacgcagacacgctggccgcccttcaagacgcagcagac
gaaatcgaggatgccctcgaaggcatcacaatcgcggcggaatga

DBGET integrated database retrieval system