KEGG   Dinoroseobacter shibae: Dshi_3643Help
Entry
Dshi_3643         CDS       T00612                                 

Definition
(GenBank) lytic transglycosylase catalytic
Organism
dsh  Dinoroseobacter shibae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT T4SS
Motif
Other DBs
NCBI-ProteinID: ABV95376
RoseoBase: Dshi_3643
UniProt: A8LT09
Position
pDSHI01:42877..44031
Genome map
AA seq 384 aa AA seqDB search
MKCRLRHILALCLLPGAAFSQGVPTNDSGLTARDIVETGDREADLAIQADKLSVRELIAE
IEREQLATLQRILDAQSSFGGQGLPAMVSGLESGSGDPDRAVEAVYGTGEIDPNRGGAQM
FGDASENIEQLIIRVAQETSGFAGVGRAGLSPVQWRALLQALIWQESRFTIGARSPVGAF
GLTQIMPGTASDLGINPDYYDSPYLQVHGGARYLATQLNTFDGNIINALAAYNAGPGRVF
EYGGVPPFRETQHYVQVIPERYNLYLSRIGGIEALGTIDPALLANANLSITGHGAAFYGS
NSPAAIRQAALRIADIVERISETEDMQESVALNTYARAELVRLVAARIRLQAARTRVLSA
EELAQASARMAEGAFMEFTIREID
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgtaggctgcgtcatatcctggccctttgcctgctgcctggcgccgccttttcc
caaggtgtgccgaccaatgacagcgggttgaccgcgcgcgatatcgtcgagaccggcgat
cgagaggccgacctcgccattcaagcggacaagctctcggtgcgagaactcatcgccgaa
atcgaacgggagcaattggccaccctgcagcgcatcctcgatgcccagagcagcttcggc
ggtcagggcctgccggccatggtctccgggctggaaagtggcagcggcgatcccgaccgc
gccgtggaagccgtctatggcacgggcgagatcgatcccaatcgcggcggtgcgcagatg
ttcggggatgcgtctgagaacatcgagcaactcatcatccgcgtcgcccaggaaaccagc
ggctttgccggcgttggccgcgcgggcctctccccggttcaatggcgcgcactcctacag
gcgctcatctggcaggaaagccggtttaccatcggcgcgcgctcgccggtcggcgccttt
ggcctcacccagatcatgcctgggacggccagcgatctcggcatcaacccggattactat
gacagcccctacctgcaggtgcatggcggcgcgcgctatctcgccacccagctcaacacc
ttcgatggcaacatcatcaacgccctcgcggcctataatgccggccccggccgggtcttt
gaatatggcggggtcccacctttccgcgaaacccagcactacgtccaggtcatccccgag
cgctacaatctctatctgagccgcatcggcgggatcgaagcgctcggaacgatcgatccg
gcgcttctggccaatgccaacctctcgatcaccgggcatggcgcggccttctatggcagc
aactcccccgctgcgatcaggcaggccgccctgcgcattgcggatatcgtcgagcggatt
tctgagacggaagacatgcaggaaagcgtcgcgctcaacacctatgcccgcgccgaactc
gtgcgtctcgtcgccgcgcgtattcgtcttcaagcggcacggacccgcgtgctttcggcc
gaggaattggcacaggccagcgcccgcatggccgagggcgcattcatggaattcacgatc
agggagatagactga

DBGET integrated database retrieval system