KEGG   Dinoroseobacter shibae: Dshi_3979
Entry
Dshi_3979         CDS       T00612                                 

Gene name
virB4
Definition
(GenBank) type IV secretion system protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dshi_3979 (virB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsh02044]
    Dshi_3979 (virB4)
Secretion system [BR:dsh02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Dshi_3979 (virB4)
SSDB
Motif
Pfam: T4SS FliJ DLP_helical YPEB Mod_r Syntaxin_2 T6PP_N PCRF Baculo_F TMP_3 MCU DASH_Dam1 Zw10 CREPT Tweety
Other DBs
NCBI-ProteinID: ABV95707
RoseoBase: Dshi_3979
UniProt: A8LTZ9
Position
pDSHI03:38371..39180
AA seq 269 aa
MRDLLVRTALATTLGIGLHLGTLSAAVAQGVPVVDTQNIAQNIQQLRQMIEDEILQNEQL
TQLREQLATLTDQLAELQRTYEALTRLAELPEIIRTEMEDELNGLLDQEFGDILATIEAI
KTGDFSGLSGSGAGEIETQMDRVLADLGFDEDTLSEMATSGNPGANRVATQATTGALVSA
AAQNSYEDAGQSLERVDRLVGLIDDMEELKQSVDLNTRVTAELAIALVAMWQLEAIQTVG
DGTGGVIDAATIAEEQRFMDFTLPDLRAE
NT seq 810 nt   +upstreamnt  +downstreamnt
atgagagatttgctcgtgaggacggcattggccacgacgcttgggatcggtctgcatctc
ggcaccctgtccgctgccgtggcgcaaggtgtgccggtcgtcgacacccagaatatcgcg
caaaacatccagcagctccggcagatgatcgaagacgagattctgcaaaacgagcagctg
acgcagctccgtgaacagcttgccacactcacggatcaactcgcggagctgcaaagaact
tatgaagcactcacccgccttgccgagcttcccgagatcatccgcacggaaatggaagac
gagttgaacggcctgctcgaccaagagttcggggacatcctcgccactattgaggcgatc
aagactggggatttctcgggcctgtccggttctggcgcaggcgaaatcgaaacccagatg
gaccgggtgctggccgatctcggcttcgatgaagacaccctctcggaaatggccaccagc
ggcaatcccggggccaaccgcgtggcgacgcaggccacgaccggtgcgctcgtctcggcg
gcggcccagaacagctatgaggatgccggccaatcgctcgagcgggtagaccgccttgtc
gggctcatcgacgacatggaagagctcaagcaaagcgtcgatctcaacacgcgcgtgaca
gctgaattggccatcgccctcgtggcgatgtggcagctggaagcgattcaaaccgtgggc
gatggcacgggcggcgtgatcgatgccgccaccatcgccgaagagcagcgcttcatggat
ttcaccttgccggacctccgggccgagtga

DBGET integrated database retrieval system