KEGG   Dinoroseobacter shibae: Dshi_3980Help
Entry
Dshi_3980         CDS       T00612                                 

Gene name
virB5
Definition
(GenBank) VirB8 family protein
  KO
K03203  type IV secretion system protein VirB8
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dshi_3980 (virB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsh02044]
    Dshi_3980 (virB5)
Secretion system [BR:dsh02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Dshi_3980 (virB5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: ABV95708
RoseoBase: Dshi_3980
UniProt: A8LU00
Position
pDSHI03:39197..39850
Genome map
AA seq 217 aa AA seqDB search
MASEQEIIEEELVYGALRRERLWQRLGLAGLVFGIIGCLSAAAVSILDVDPPPVVVPYDP
ATGFALPEASVGASSVTANQAIIEAEVFRYVTDREIYNQLDNDLRIRSVLRRSDGAAESR
LRQIWNSANENYPPTVYGPNARLDVEILSINRIGSNRATVRLRKRLTSINGTQTGLFTAT
LLFEFRPETRRSIDEVWTNPFGFTVLEYSIRSDRLEN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagtgaacaagagatcatcgaggaagaactggtctacggtgccttgcgccgcgaa
cggctctggcaacgccttggtctggcaggtcttgtcttcggcatcatcggctgtctgagt
gccgcggctgtctcgatcctcgatgtcgatccgccccccgtcgttgtcccctatgatccc
gctaccggctttgcactccccgaggcctcggtgggcgcttcctcggtgaccgccaaccag
gcgatcatcgaggcggaggtcttccgctatgtgaccgaccgggagatctacaatcagctc
gataacgatctgcgcatccgcagcgtcctgcgccgctcggacggggccgccgagagcagg
ctgcgccagatatggaacagcgcaaatgaaaactatccaccgaccgtctatggccccaat
gcccggctcgacgtggaaattctcagcatcaaccggatcggatccaaccgcgccaccgtg
cgcttgcgcaagcggctgacctccatcaacggcacccagaccgggctcttcaccgccacg
cttctcttcgagttccgtcccgaaacccgtcgctccatcgacgaggtctggaccaatccg
tttgggtttaccgtgctcgaatattccatccgctccgacagattggagaactga

DBGET integrated database retrieval system