KEGG   Dinoroseobacter shibae: Dshi_4159Help
Entry
Dshi_4159         CDS       T00612                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dshi_4159
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Dshi_4159
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Dshi_4159
    1.1.1.-  
     Dshi_4159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABV95869
RoseoBase: Dshi_4159
UniProt: A8LUF2
Position
pDSHI05:6606..7658
Genome map
AA seq 350 aa AA seqDB search
MKAARWHGAKDIRVEDVDEPTPGAGEVKIKVAWTGICGSDLHEFLAGPIFVPVGEDHPLS
HDKAPITMGHEYCGEITELGDGVTDLSVGDRVAIEPIFACGTCAACRDGRYNLCEKLGFV
GLSGGHGGFAAYSVVPARMLHRMPEGLSMEQGALVEPAAVALHAVRVSAFKAGDRAAVFG
AGPIGLLVVESLRIAGASKIVVVEPSETRRAKAMELGATTAVDPGAEDAVAAVQAACPGG
VEVAFEVTGVPAVLAQAIDATRYEGETLVVSIWETEASFQPNTVVLKERNIKGTIAYRNV
YPAVMDLMQQGYFQAERLVTRRIGLDDIVRDGFEALVAEKSQIKILVEAP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcacgttggcatggcgcgaaggacattcgcgtcgaggatgtggacgaaccg
acccccggcgcgggggaggtcaagatcaaggtcgcctggaccgggatttgcggcagcgac
ctgcatgaatttctcgctgggccgatcttcgtgccggtgggggaggatcaccccctcagc
cacgacaaggccccgatcaccatgggacacgagtattgcggcgagatcaccgagctgggc
gacggggtcacggacctgtcggtcggggaccgggtggcgatcgagccgatcttcgcctgc
ggcacctgcgcggcctgtcgcgacgggcggtacaacctgtgcgaaaagctgggcttcgtc
ggcctgtccggtggccatggcgggtttgcggcctattcggtggtgcccgcgcgcatgttg
cacaggatgcccgagggcctgtcgatggaacagggcgcgctggtcgagccggcggcggtc
gccctgcacgcggtacgggtcagcgcgttcaaggccggggacagggcggcggtgttcggg
gccggtcccatcgggctgctggtggtcgaatcgctccggatcgcgggggcctccaagatc
gtggtggtcgagccgtccgagacccgccgcgccaaggccatggagttgggcgcgaccacg
gcggtcgatcccggggcggaggatgccgtcgccgccgtccaagccgcatgcccggggggc
gtcgaggttgccttcgaggtgaccggcgtgcccgcggtgctggcgcaagccatcgacgcg
acccgctacgagggcgagacgctggtggtgtcgatctgggaaaccgaggccagtttccag
cccaacaccgtggttctgaaggagcggaacatcaaggggacgattgcctatcgcaacgtc
tatccggcggtgatggacctgatgcagcaaggctatttccaggccgaacggctggtgacg
cgccggatcgggctggacgatatcgtgcgcgacgggttcgaggcgctggtggccgagaaa
tcccagatcaagatcctggtcgaagcgccctga

DBGET integrated database retrieval system