KEGG   Drosophila simulans: Dsimw501_GD11042
Entry
Dsimw501_GD11042  CDS       T01065                                 
Symbol
Dsim_GD11042
Name
(GenBank) uncharacterized protein, isoform A
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
dsi  Drosophila simulans
Pathway
dsi03022  Basal transcription factors
dsi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    Dsimw501_GD11042 (Dsim_GD11042)
  09124 Replication and repair
   03420 Nucleotide excision repair
    Dsimw501_GD11042 (Dsim_GD11042)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dsi03021]
    Dsimw501_GD11042 (Dsim_GD11042)
   03400 DNA repair and recombination proteins [BR:dsi03400]
    Dsimw501_GD11042 (Dsim_GD11042)
Transcription machinery [BR:dsi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dsimw501_GD11042 (Dsim_GD11042)
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Dsimw501_GD11042 (Dsim_GD11042)
SSDB
Motif
Pfam: PH_TFIIH BSD FKBP26_C
Other DBs
NCBI-ProteinID: KMY93749
FlyBase: FBgn0182802
UniProt: B4QFG2
Position
2R
AA seq 584 aa
MTTSSEDVLLQMGEVRYKKGDGTLYVMNERVAWMAEHRDTVTVSHRYADIKTQKISPEGK
PKVQLQVVLHDGNTSTFHFVNRQGQAAMLADRDKVKELLQQLLPNFKRKVDKDLEDKNRI
LVENPNLLQLYKDLVITKVLTSDEFWATHAKDHALKKMGRSQEIGVSGAFLADIKPQTDG
CNGLKYNLTSDVIHCIFKTYPAVKRKHFENVPAKMSEAEFWTKFFQSHYFHRDRLTAGTK
DIFTECGKIDDQALKAAVQQGAGDPLLDLKKFEDVPLEEGFGSVAGDRNVVNSGNIVHQN
MIKRFNQHSIMVLKTCANVTSAPSTMTNGTNNANGPVSQSAYTNGMNGKAQATATKSSAD
QVDKDEPQSKKQRLMEKIHYEDLGDPLLEGEDDPANGEKAKSKQFELSKVERYLNGPVQN
SMYDNHNDPMSLEEVQYKLVRNSESWLNRNVQRTFICSKAAVNALGELSPGGSMMRGFQE
QSAGQLVPNDFQRELRHLYLSLSELLKHFWSCFPPTTEELETKLQRMHETLQRFKMAKLV
PFENRAMHELSPLRSSLTQHMNQLLRTANSKFATWKERKLRNNR
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgaccaccagcagtgaggacgtgctgctccagatgggcgaggtgcggtacaagaagggc
gacggcacgctctacgtaatgaacgagcgtgtggcctggatggcggaacacagggacacg
gtgacagtctcccatcgttatgcggatatcaagacccaaaagatatctcctgagggaaaa
cccaaggtgcagctgcaagtggtactccacgacggaaacacatcaaccttccactttgtc
aaccgccagggacaggccgccatgcttgccgacagagacaaggtcaaggagctgttgcag
caactgcttcccaactttaagcgcaaggtggacaaagacctggaagacaagaaccggatc
cttgttgagaatcccaacctgctgcagctctacaaggaccttgtcataaccaaagtccta
accagcgatgagttctgggctacgcatgccaaggatcacgcccttaagaaaatgggcagg
tcccaggagatcggtgtttctggcgcctttttggccgacataaaaccgcagacagacggc
tgtaatggcctcaagtacaacctcacctctgatgtgattcactgcattttcaagacctat
cccgccgttaaacgcaaacattttgagaatgtgcctgccaaaatgtccgaggccgagttt
tggaccaagtttttccaatcacactactttcatcgtgacagactgacagccggcacaaaa
gatatatttacggagtgcggcaagatcgatgatcaggcattaaaagcggctgtccagcaa
ggagctggtgatcctttgctagaccttaaaaagtttgaggatgttcctttggaagagggc
tttggcagcgtagccggggaccgcaacgtcgtaaacagcgggaatattgtgcaccaaaac
atgatcaagcgattcaaccagcattccatcatggtgctcaagacctgtgctaacgtgacc
tcagcgccgtcaactatgacaaatggtaccaataatgccaacgggcctgtttcccaatcc
gcctatacgaacggtatgaatggaaaggcccaggccaccgcaacgaagagttccgccgat
caggtggacaaagacgagccgcagagcaaaaagcaacgactgatggaaaagattcactat
gaggatctcggggatcctctattggagggagaagatgatcccgccaacggcgagaaagcc
aagtctaagcagttcgaactgtccaaagtggagcgttacctcaatggccctgtccagaac
agcatgtacgacaaccacaacgatccaatgagtctggaagaggtacagtacaagctggtg
cggaattcggagtcatggctaaatcgcaacgtgcaacgaacgttcatctgttccaaggcg
gcagtaaatgctctgggtgaactaagtcctggcggttccatgatgcgcggtttccaagag
cagtcagcgggtcaacttgtgccgaatgacttccaacgagagctgcgccacttatacctt
tcgctgtccgagctgctgaaacacttttggagctgctttccgcccaccacagaagagttg
gagacaaaattacagcgtatgcacgagacgttgcagcgcttcaaaatggcaaaactagtg
ccttttgagaaccgcgctatgcacgaactctcgccactgcgatcctcgctgacgcagcac
atgaaccagctgctgcgcaccgccaacagcaagttcgccacttggaaggagcgaaaactg
cgtaacaacaggtag

DBGET integrated database retrieval system