KEGG   Drosophila simulans: Dsimw501_GD11572Help
Entry
Dsimw501_GD11572  CDS       T01065                                 

Gene name
Dsim_GD11572
Definition
(RefSeq) GD11572 gene product from transcript GD11572-RA
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dsi  Drosophila simulans
Pathway
dsi00790  Folate biosynthesis
dsi01100  Metabolic pathways
Module
dsi_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dsimw501_GD11572 (Dsim_GD11572)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dsimw501_GD11572 (Dsim_GD11572)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 6735503
NCBI-ProteinID: XP_002082442
UniProt: B4QFN5
Position
2R
AA seq 273 aa AA seqDB search
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKSSQQLKLDMLNLE
LASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERA
AKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLP
CNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGV
QKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccagaccagcgagcaaaacggcagtggccaaaatggcgagggagccgcggat
gccgtggccgttgccacgatccccacgggcgaagcctccgccgcctccgccacgtccggc
accgatctaacggtctccaaaagcagccagcagctgaaactggacatgctcaacttggag
ctggccagcaatggaagcggccacgagaagtgcacgttccaccacgacctggagctggac
cacaagccgccgacgcgggaggcccttctcccggacatggcacgctcgtatcgcctactc
ttgggcggcctgggcgagaatcccgatcgccagggactgatcaagacgccggagcgggcg
gccaaggccatgctgtacttcaccaagggctacgaccagagtctcgaggatgttctcaat
ggcgccgttttcgacgaggatcatgacgaaatggtggtggtcaaggacattgaaatgttc
tccatgtgcgagcatcatctggtgcccttctacggcaaagtttccatcggctacttgccg
tgcaacaagattctcggactcagtaaattggcacgcattgtcgaaatattttcgcgtcgc
ctgcaagtccaggagcgcttgaccaagcagatcgcagtggccgtgactcaggccgtgcaa
cccgctggagtggcagtggtcgtagagggagtccacatgtgcatggtgatgcgtggcgtg
cagaagatcaacagcaaaactgttacctcaactatgctgggcgtgttccgagacgatccc
aagacccgtgaggaattcctgaacttagtcaatagcaaatag

DBGET integrated database retrieval system