KEGG   Drosophila simulans: Dsimw501_GD12518
Entry
Dsimw501_GD12518  CDS       T01065                                 

Symbol
Dsim_GD12518
Name
(GenBank) uncharacterized protein, isoform A
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
dsi  Drosophila simulans
Pathway
dsi04120  Ubiquitin mediated proteolysis
dsi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dsimw501_GD12518 (Dsim_GD12518)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    Dsimw501_GD12518 (Dsim_GD12518)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dsi01002]
    Dsimw501_GD12518 (Dsim_GD12518)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dsi04121]
    Dsimw501_GD12518 (Dsim_GD12518)
Peptidases and inhibitors [BR:dsi01002]
 Peptidase inhibitors
  Family I32: IAP family
   Dsimw501_GD12518 (Dsim_GD12518)
Ubiquitin system [BR:dsi04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    Dsimw501_GD12518 (Dsim_GD12518)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_UBOX Rad50_zn_hook zf-RING_5
Other DBs
NCBI-ProteinID: KMY99901
FlyBase: FBgn0184246
UniProt: B4QLT4
Position
3L
AA seq 430 aa
MASVVADLLSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNSEEARLKTFTDWPLDWLD
KRQLAQTGMYFTHTGDKVKCYFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPI
NGEALDRILPPISYDICGANDSTLEMREHAYSEGAIPMSQLIQSIGVNTANAATSATGTA
SPQPRVMVATHASTATQATGDVQPETCRPAAASGNYFPQYPEYAIETARLRTFEAWPRNL
KQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQL
YIDTVAAKPELAEEKEESSSMASTQASEEEQQTSGEAGSGDVAPSVAPTAATRIFNKIVE
ATAVAPPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKP
FTDVMRVYFS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggcatctgtggtagccgatcttctgtcttatggacctatcgctttcgatcaggtggat
aacaacacgaacgcgacgcagctattcaaaaacaatataaacaaaaccagaatgaacgat
ttaaacagcgaggaggcgcgcctaaagaccttcaccgactggccgctggattggctggat
aaacgccaattggcccaaacgggcatgtactttacacacaccggcgacaaagttaaatgc
tatttctgcggcgtggaaatcggttgctgggagcaggaggatcagcccgtgccggagcat
cagcgatggtctcccaactgcccactgttgcgccggcgcactaccaacaatgtaccgatc
aatggcgaagcattagatcgcatcctgccgccaatcagctacgatatctgcggcgccaac
gactcgacgctggagatgagggagcatgcctactcagaaggcgccatacccatgtcgcag
ctaattcagtcgattggcgtgaatacagcaaatgcggcaaccagtgcaactggaaccgca
tccccgcaaccgagggtaatggtcgccacccatgcgtcgacggcgacgcaggccactggc
gatgtccagccggagacgtgtcgtccagcagccgccagtggcaattattttccccagtat
cccgaatacgccatcgagacggcacgcctgcgcaccttcgaggcttggccgaggaatctg
aaacagaagccccaccagctggccgaggcgggattcttctacacaggcgttggggatcgc
gtccgctgcttcagttgcggcggtggtctcatggattggaacgacaacgacgagccctgg
gaacagcacgccctctggctaagtcagtgccgattcgtcaagctgatgaagggtcagctc
tatatcgatacggtggccgccaaaccagagctggccgaggagaaggaggagagctcttcg
atggccagcacacaggcttcagaggaagagcagcagacatcgggggaggccggttcgggg
gatgttgctccgtccgtagctcccacggcagccacacgcatcttcaacaagatcgtcgag
gcgacagcggtggctcctccctcgacaaacagcagcggctccacctccatacccgaggag
aagctgtgcaagatctgctacggcgccgagtacaatacggcattcctgccatgcggtcat
gtggtggcctgcgccaagtgcgcctcctctgtgacaaagtgcccgctgtgccggaagccc
ttcaccgatgtgatgcgcgtatatttttcttaa

DBGET integrated database retrieval system