KEGG   Drosophila simulans: Dsimw501_GD14837
Entry
Dsimw501_GD14837  CDS       T01065                                 
Symbol
Dsim_GD14837
Name
(GenBank) uncharacterized protein
  KO
K03028  26S proteasome regulatory subunit N1
Organism
dsi  Drosophila simulans
Pathway
dsi03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    Dsimw501_GD14837 (Dsim_GD14837)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dsi03051]
    Dsimw501_GD14837 (Dsim_GD14837)
Proteasome [BR:dsi03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     Dsimw501_GD14837 (Dsim_GD14837)
SSDB
Motif
Pfam: RPN1_RPN2_N PC_rep RPN1_C HEAT_2 AP3D1 DUF3915 Utp13 Atrophin-1
Other DBs
NCBI-ProteinID: KMZ00641
FlyBase: FBgn0186510
UniProt: B4QRD0
Position
3L
AA seq 919 aa
MTGETKLEKKPLKPAASEGDAKDPKAKKDEKKDSKDKEQQPELSDEDQQLQEELELLVQH
LQEPDVKLYQPTLESMAKLIRASTTSMTSVPKPLKFMRPHYETMKTVYKHMPNEQARQLC
ADIISVLSMTMGSGKDCLAYRFLCDRKQRIGDWGHEYVRHLSGEISAHYHDTTGDFRVQL
IELVKQIIPYNMEHNAEADACDLLIEIDHLHLLSDFVDESAYPRVCLYLQSCYPYVPDPD
NTIILETALQLSRKFNQYTQAMRLALMLNDMDKIGEIFKEPKEPAMQKQLAFMLARQQIC
LELDESVPDYDDLMEIMSNANLNKHFLNLARELDIMEPKTPEDIYKSHLDNSRSRFASIQ
VDSAKQNLAASFVNGFVNAGFGVDKLLSEDGNKWLYKNKEHGMLSATASLGLILLWDVDG
GLTMIDKYLYSTDDNIKSGALLACGIVNCGIRNEVDPAHALLSDYIDNQNSCMRVGAILG
LGIAYAGSNRSIVIDTLKTVFSFGSNNKSSASVEILGITALSLGLISVGSCNSEITEILL
QTIMGLTKADLKDTYSRFLFLGLGLLYLGRQKSTEAVMMTLEVLEEPYRSMATTMVDICA
YAGTGNVLKIQQLLHICSDHYETSSADDEKEKSKKDKGKDKDKEKEKEKEKEREKDLSAT
QSIAVLGIALIAMGEDIGAEMAYRSFGNLLRYCEPAIRRAVPLALGLISASNPKLNIIDT
LSKFSHDSDAEVAHNAIFAMGLVGAGTNNARLASMLRQLAQYHSKDPSNLFMVRIAQSLT
HLGKGTLSLSPYHSDRQLMNPMAVAGLMATLVSLLDVKNLILNRSHYLLYTLVPAMQARM
LITFDEELNQLQVPVRVGIAIDVVGQAGKPKTITGFQTHTTPVLLAIGERAELATDEYLA
LTPVMEGFVILKKNPNFVK
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgacgggcgagaccaagctggagaagaagccgctgaagccggcggcatccgaaggcgat
gccaaggatccgaaggccaagaaggatgaaaagaaggacagcaaggacaaggagcagcag
ccggagctctccgacgaggaccagcagctgcaggaggagctggagctgctggtgcagcac
ctgcaggagccggatgtgaagctctaccagccgacgctggagagtatggccaaattgatc
agggcctccacgacgtcgatgacctcggtgcccaagcccttgaagttcatgcgcccgcac
tacgaaaccatgaagacggtgtacaagcacatgcccaatgagcaggcccgccagttgtgc
gccgacatcatctcggtgctctcgatgaccatgggcagcggcaaggattgcctggcctac
cgcttcctctgcgatcgcaagcagcgcatcggggactggggccatgagtatgtgcgtcat
ctgtctggcgaaatttctgcccactatcacgatacaacgggtgactttcgtgtgcagctc
atcgaactggtcaagcagatcatcccgtacaatatggagcacaatgccgaggctgatgcc
tgcgatctgctgatcgaaatcgatcacttgcacctgttgagcgactttgtggacgagtcg
gcctatccccgcgtctgtctctatctgcagtcctgctatccgtacgttcccgacccggac
aacaccatcatcctggaaaccgcgctccagctgtcgcgcaagttcaaccagtacacacag
gccatgcgactggcgttgatgctcaacgatatggacaagatcggtgagatcttcaaggag
cccaaggagccggccatgcagaagcagctggcctttatgctggcccgccaacagatttgc
ctggagctggatgaatcggtgccggactacgatgatctcatggagatcatgtcgaatgct
aatctgaacaagcatttcctcaatctagctcgcgaactggacatcatggagcccaaaacg
ccggaggacatttacaagtcgcatttggacaactcgcgctcccgctttgcatccatccag
gttgactctgccaagcaaaatctagccgctagctttgtaaatggttttgttaacgccggt
ttcggggtggacaagttgctgtcggaagacggaaacaaatggttgtacaagaacaaggag
cacggcatgctctcggccaccgcatcgctgggtttgatccttctgtgggatgtggatggc
ggtctgaccatgatcgataagtacttgtactccaccgatgacaacatcaagtccggcgct
ttgttggcttgcggaatcgtcaactgcggcatccgcaacgaggtcgatccggctcatgcc
ctgctctccgattatatcgacaaccagaactcctgcatgcgcgttggcgccatcctcggt
ctgggcatcgcctacgctggctccaatcgctccattgtgatcgacaccctgaagacggtc
ttctcgtttggcagcaacaacaagagttcggccagcgtggagatattgggtattacagct
ctgtcgctgggtctcatcagtgttggttcgtgcaattcggagatcaccgagatcttgctg
cagacgatcatgggtctgaccaaggccgatctgaaggacacctactcgaggttcctgttt
ttgggtctgggtctgctttacctgggccgccagaagtccaccgaagccgtgatgatgacg
ctggaggttttggaagagccgtaccgcagcatggccactaccatggtggacatttgcgca
tacgctggcactggcaacgtgctcaagatccaacagctgctccacatctgctccgatcac
tacgagacgtccagtgccgatgacgagaaggagaagagcaagaaggacaagggcaaggat
aaggacaaggagaaggagaaagagaaggaaaaggagcgcgagaaggacttgtcggccacc
caatcgatcgccgtgctgggaattgccctgatcgccatgggcgaggacattggcgccgag
atggcataccgctcgttcggaaacctgctgcgctattgcgagccagccatccgccgggcc
gtgccactggcgttgggcctgatatccgcctccaatcccaagctgaatatcatcgacacg
ctgagcaagttctcgcacgacagcgacgccgaggtggcccacaatgcgatcttcgccatg
ggcttggtgggcgccggcacgaataacgcccggctggcctccatgctgcgccagttggcg
cagtaccattcgaaggatcccagcaatctgttcatggtgcgcatcgcccagagcttgacg
cacttgggcaagggcaccctctcgctgagtccctaccacagcgataggcagctgatgaac
cccatggccgtcgctggactgatggccacgctggtctccctgctggatgtgaagaacctg
atactgaaccgatcgcactatctgctctacacactggtgcccgccatgcaggcgcgcatg
ctgatcaccttcgacgaggagctcaaccagctgcaggtccctgtgcgcgtcggcatcgcc
atcgatgtggtcggccaggcgggcaagccgaagaccatcaccggcttccagacgcacacc
acgcccgtcctgctcgccattggcgagcgcgccgagctggccaccgatgagtatctggcc
ctcaccccggtcatggagggcttcgtcatactcaaaaagaaccccaactttgtgaaatag

DBGET integrated database retrieval system