KEGG   Drosophila simulans: Dsimw501_GD15306
Entry
Dsimw501_GD15306  CDS       T01065                                 
Symbol
Dsim_GD15306
Name
(GenBank) uncharacterized protein
  KO
K02358  elongation factor Tu
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dsi03012]
    Dsimw501_GD15306 (Dsim_GD15306)
   03029 Mitochondrial biogenesis [BR:dsi03029]
    Dsimw501_GD15306 (Dsim_GD15306)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD15306 (Dsim_GD15306)
Translation factors [BR:dsi03012]
 Eukaryotic type
  Elongation factors
   Dsimw501_GD15306 (Dsim_GD15306)
 Prokaryotic type
   Dsimw501_GD15306 (Dsim_GD15306)
Mitochondrial biogenesis [BR:dsi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dsimw501_GD15306 (Dsim_GD15306)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsimw501_GD15306 (Dsim_GD15306)
  Exosomal proteins of breast cancer cells
   Dsimw501_GD15306 (Dsim_GD15306)
  Exosomal proteins of colorectal cancer cells
   Dsimw501_GD15306 (Dsim_GD15306)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Other DBs
NCBI-ProteinID: KMY92005
FlyBase: FBgn0186974
UniProt: A0A0J9TVD3
Position
2R
AA seq 456 aa
MSGLLPKLWRQCEVGLVRRISQSLIGPGASQSRWTGTRLLASSADKNPASGLRELPHCNV
GTIGHVDHGKTTLTAAITKIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIGYSTTER
TYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRIIVFI
NKADLVDQEVLELVEIEMREMLSDFGFDGVNSPVICGSALLALREDKSEFGVPSIEKLLE
QCDTYIPTPQRDIASPFILPIDNAFTVPGRGTVVVGTIKRGTIPRNADADLLGFNQNLKT
SISDIQIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGSEDISNHFEGSMYLLSR
AEGGRVKPMLSKYIQQLFSQTWNVPARIDIVPSEAMLMPGEHGQVRVTLLRKMVMTPGQA
FTIRENGATVATGMVTQRLRSLDLPKNKLSKVLVDC
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagcggactccttccgaagttgtggcgccaatgtgaagtggggctagtgcgccggatc
agccagtcactgattggacccggcgccagtcagagccgttggacagggactcgtctccta
gcctccagtgcggataaaaatccggcctctgggctgcgggagctgccccactgcaatgtg
ggcaccattggtcacgtggaccatggtaaaacgaccctgaccgccgctattaccaaaatc
cagtcacagaagggtctggcggagtacctgtcctacgaccagatcgatcgcgcgcccgag
gagaaggcgcgcggcataactataaatgcttgtcatattgggtattccactacagagcgg
acctacgctcacacggattgcccgggtcatgcggactacataaagaacatgatctcgggc
gcctcccaaatggatggcgccatcctagtggtggccgccaccgatggccaaatgccccag
actcgcgagcaccttcttctggccaaacaagtgggcatccagcgcatcatagtgtttata
aacaaggccgatttggtggaccaggaggttctggaactggtcgaaatcgagatgcgtgag
atgctaagtgatttcggctttgatggcgttaatagtccggttatttgtggctcggcgctg
ctggcccttcgcgaggataaatcggagttcggggttccgtcaattgaaaagctacttgag
caatgcgacacttacataccaacgccgcagcgcgatatcgcgtccccatttatcctgcca
atagacaatgcttttacggtacccggaaggggaaccgtggtcgtgggaaccatcaaaagg
ggcaccattccccggaacgcggatgccgacctactgggcttcaatcagaacctgaagacg
agcatcagcgacatccagatattccggaagagcgtgccccaggcacaggctggcgagaac
gtcggcgcactgctgcgaggtattaagatatccgccgtggagcggggaatgctgctgtgc
gcgaccggctccgaggatatatccaaccacttcgaaggctccatgtacctgctatcgcgg
gccgagggcggtcgtgtcaagcccatgctctccaagtatatacagcagctcttcagccag
acgtggaatgttccagccagaattgacatagttccaagtgaggctatgcttatgccgggt
gagcatggccaggtgcgcgtcacgctgctgcggaaaatggtcatgacgccgggccaagcc
ttcacaattcgcgagaacggagcgacggtggctaccggaatggtgacgcagcgcctgcgg
tcccttgacctgcccaagaacaagttatcaaaagtcttggtggattgttaa

DBGET integrated database retrieval system