KEGG   Drosophila simulans: Dsimw501_GD20486
Entry
Dsimw501_GD20486  CDS       T01065                                 
Symbol
Dsim_GD20486
Name
(GenBank) uncharacterized protein, isoform A
  KO
K03102  squid
Organism
dsi  Drosophila simulans
Pathway
dsi04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dsimw501_GD20486 (Dsim_GD20486)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dsi03019]
    Dsimw501_GD20486 (Dsim_GD20486)
   03041 Spliceosome [BR:dsi03041]
    Dsimw501_GD20486 (Dsim_GD20486)
Messenger RNA biogenesis [BR:dsi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     Dsimw501_GD20486 (Dsim_GD20486)
Spliceosome [BR:dsi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   hnRNP proteins
    Dsimw501_GD20486 (Dsim_GD20486)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2
Other DBs
NCBI-ProteinID: KMZ03777
FlyBase: FBgn0191957
Position
3R
AA seq 345 aa
MAENKQVDTEINGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFV
GGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIEKVSAVEEHI
INSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFC
FITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGG
RGGYNNQWDGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYG
GGGGGNMGGGRGGPRGGGGPKGGGGGFNGGKQRGGGGRQQRHQPY
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggccgagaacaagcaagtggatactgaaattaacggcgaggatttcaccaaggacgtg
actgccgacggtccgggatctgaaaatggtgatgcgggcgccgccggctcgaccaacggc
agttcggacaaccaatcggctgcatccggccagcgggacgacgacaggaaactgtttgtc
ggtggtctgagctgggaaacgactgagaaggaactccgcgatcacttcggcaaatatggc
gagatcgagagtatcaatgtcaagacagatccccagaccggtcgatcccgaggattcgcc
ttcatcgtgtttacaaacaccgaggccattgaaaaggtcagcgccgtggaggagcacata
atcaacagcaagaaggtcgatcccaagaaggccaaggccaggcacggcaagatctttgtc
ggtggcctcaccacagagatcagcgacgaggagattaagacctactttggacagtttggc
aacatcgtcgaggtggagatgccattcgacaagcaaaagtctcagcgcaagggattctgc
ttcatcaccttcgattcagagcaggtggtgacggatctgctgaagacgcccaagcagaag
atcgccggcaaggaggtcgatgttaagcgtgcgacgcccaagccggagaaccagatgatg
ggcggtatgcgtggtggcccacgcggcggtatgcgcggcggacgcggtggctacggagga
cgcggtggctacaacaaccagtgggacggacagggatcatacggcggctatggcggcggc
tacggcggatatggtgccggtggctatggcgactactatgccggcggctactataatgga
tatgactacggttatgacggctacggttacggcggcggctttgagggtaacggctacggc
ggaggcggtggtggcaatatgggcggtggtcgcggtggaccccgcggcggcggcggcccc
aaaggcggcggtggcggttttaacggtggcaagcagcgcggaggcggtggacgccagcag
cggcaccagccctactaa

DBGET integrated database retrieval system