KEGG   Drosophila simulans: Dsimw501_GD21829
Entry
Dsimw501_GD21829  CDS       T01065                                 

Symbol
Dsim_GD21829
Name
(GenBank) uncharacterized protein, isoform B
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
dsi  Drosophila simulans
Pathway
dsi00230  Purine metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dsimw501_GD21829 (Dsim_GD21829)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     Dsimw501_GD21829 (Dsim_GD21829)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     Dsimw501_GD21829 (Dsim_GD21829)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2
Other DBs
NCBI-ProteinID: KMY90824
FlyBase: FBgn0193249
UniProt: A0A0J9R528
Position
2L
AA seq 1407 aa
MASSPNNAAPPVLWRARRKIGLHLRSIEEPATTPLQFQPTGRMNTEQGGTGYGGYGSSEH
SLLIATRHAGVPLPLAQHQPLPAHYQPLNHSGPAPPSSSNGSSSSGGGVQTSATPQQQQQ
YQVQQPYQYQHHYHHQANSPQHHRPYDPEHARMEAWLDENQEFVQDYFIRKATRQTVDAW
LVSHATSAGNDVVSSTSPTHANGQTSSSRGGSGATTPVRKISAHEFERGGLLKPIVNTID
GTPTFLSIGPPMDNGGVSGSCSNLQNVGGVVAGQYQYHHQQHHHNHAHLHHSQHSHYQAG
GAVGSSSLGSTGGASGAGGAPGLGGSGGAGNGHQYPYYHCHQRPQRLSRNELKQLDEKEL
IFELVKDICNELEVRTLCHKILQNVSILLNADRGSLFLVQGRCNGPDGLKKCLVSKLFDV
CPRSTVEEMEQQDEVRVAWGTGIAGHVAESGEPVNIPDAYQDERFNCEIDSLTGYRTKAL
LCMPIKDSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIK
RNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFDFEA
NDLSEEEATSRTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHR
SILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVA
MAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFKFDDIHFEDDDTLKACLRM
FLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFG
EIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYSTSTMEHHHFDQCLMILNSPGNQ
ILANLSSDDYCRVIRVLEDAILSTDLAVYFKKRGPFLESVSQPTSYWVAEEPRALLRAMS
MTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVN
FIDSICLPIYEAFATLSDKLEPLVEGVRDNRGHWIDLADVVKTKTSQDQEPEEEQQQQQQ
NVISNGDCKAMSDDDVAAAEAEVAVDSPSEKASVNGSNVANNSSNTNKKIAVASHPTSTQ
PSDDDDDGNADADDVDEQAAEENGHDAEVDEASCRSNSTCSSSTASSRLSTPPPTGEDDS
TPVSPSKTLQAKLVAANLNALQRQTSNQAQTQKQRCKSCDHSRSGLQVRKTSSLRGAQEL
ELDSKARNGTHAALCKSTPVINNHSHHHNHSHSHNHNHHHHHHHHSHHNHSQHGIGIGSA
SIGGSGLISLATPLLAMDSDRIPKIVGKIGNLDGLPFANGIGGPQNGHGLPFGSYQHHHH
QQHHHHLLARRHSETNSNGATAMAVEK
NT seq 4224 nt   +upstreamnt  +downstreamnt
atggcatcatccccaaataacgcggcgccgcctgttttatggcgggcgagacgtaaaatt
ggcctgcatctgcggagcatcgaggagccagcgacgacgccgctccagttccagcccact
ggcaggatgaacacggagcaggggggcacggggtacggcggctacggatccagcgagcac
tcgctgctcatcgccacacgccacgccggtgtccccctgcccctcgcccagcaccagcca
ctccccgcccactatcagccgctgaaccactccggaccagccccgccctcctcctccaac
ggatcatcctcctccggcggcggagtccagacgtcggccacgccgcagcaacagcaacag
taccaggtgcaacagccgtaccagtaccagcatcactatcaccaccaggccaactcgcca
cagcaccacagaccctacgatccggagcacgcgcggatggaggcctggctggatgagaat
caggaatttgtacaggattattttataaggaaagccacacgtcagaccgtggatgcctgg
ctggtttcccatgccacatcggcgggcaacgatgtggtcagcagcacctcacccacacac
gccaatggacagacgagctcctcgcggggtggatccggtgccaccacaccagtgcgaaaa
atctctgctcacgagtttgagcgcggcggactgctgaaaccgattgtcaacacaatcgac
ggcacgcccacatttttgagcattggtccgccgatggacaacggcggcgtgagcggcagc
tgcagcaatctgcagaatgtcggtggcgtcgtggccggacagtatcagtatcaccatcag
cagcaccaccacaatcatgcccatctgcaccacagccagcacagtcattaccaggcgggc
ggggccgttgggagcagcagcttgggcagcaccggtggcgcttcgggagcgggaggagca
cccggtctgggtggcagcggtggagccggaaatggccatcaatatccatactatcattgc
caccagcgaccacagcgcttgtcacgcaacgagctcaagcagctggacgagaaggagttg
attttcgagctggtgaaggacatttgcaacgagctcgaggtgcgcactttgtgccacaag
atactccagaacgtgtccattctgctgaatgccgatcgaggatctctgttcctggtgcaa
ggacgatgcaacggacccgatggcctaaaaaaatgcctcgtctccaagctgttcgatgtg
tgcccccgcagcaccgtggaggaaatggagcagcaggacgaagtgcgggtggcatggggc
acgggaatcgccggccatgtggccgaaagcggggagcccgtcaacataccagatgcttac
caggacgagcgattcaattgtgaaattgactcgctgaccggctatcggacgaaggccttg
ctctgcatgcccatcaaggattcatccggggatgtgattggcgtggcgcaggtcatcaac
aaaatgaatggcgagtgtttctccgaaatcgatgaaaaggtcttttcctcgtatctgcaa
ttctgtggcattggcctgcggaacgcacagctgtatgagaaatctcaactggagatcaag
cggaatcaagtgctcctggatctggcacgcatgatcttcgaggagcagagcaccatagag
cacatggtcttccgcattctcacccacatgcagagtctcatccagtgccagcgcgtccag
atcctcctggtccacgaggcggacaagggcagcttctcgcgggtctttgacttcgaggcg
aatgacctgagcgaggaggaggccacttcacgcaccagcccctacgagtcgcggtttccc
atcaacattggtatcaccggacatgtggccaccaccggggaaaccgtaaatgtgcccaat
gcctatgaggacgatcgcttcgatgcgagcgtggacgagaactcctgcttcaagcaccga
tctattctatgcatggccatcaagaactcgctgggtcagatcattggtgtgatccagctg
atcaacaagttcaatgagttggacttcaccaagaacgacgagaactttgtggaggcgttc
gccatcttctgcggcatgggcatccacaacacgcacatgtacgagaaggccattgtggca
atggccaagcagagtgtcaccctggaggtgctcagctaccacgcatcggccaccatggac
gaggctcatcggctgcggcgccttcgggtgccttcagctgtacactttcgactgcatgac
tttaagttcgatgacatacactttgaagatgatgatacactaaaggcctgcctgcgcatg
tttttggatctcgattttgtagaacgctttcatatcgactatgaagttctgtgccggtgg
ctattgagtgtcaagaagaactatcgaaatgttacctatcacaactggcgtcatgccttc
aatgtggcccaaatgatgtttgccattcttacaaccacacaatggtggaagatctttggt
gaaatcgaatgcttggcgcttattattgggtgcctatgtcatgatctcgatcatcggggg
accaacaactccttccagattaaagcctcgtcgcctttggcgcagctgtactcaacctcc
accatggaacaccatcactttgatcagtgtctaatgatcctgaatagtcctggaaatcaa
attctggccaatctctcatccgatgactactgtcgggtcattagggtattggaagatgcc
attttgtccactgacttggccgtgtatttcaagaaacgaggtcctttcttggagagtgtg
agccagccgacgagctactgggtggcggaggagccgcgcgcccttttgcgtgcaatgagc
atgactgtctgtgatttgtcggccatcacgaagccgtgggagattgagaagcgtgtggcc
gatttggtgagctcggagttcttcgagcagggagacatggagaaacaggagctcaatata
actcctattgatatcatgaatcgcgaaaaggaggacgagctgcccatgatgcaagtaaac
tttatagactcgatttgcttgccaatctatgaggcctttgccaccctctccgacaagctt
gagcctcttgtcgagggcgtgcgcgataatcggggccattggattgatctggccgatgtc
gtgaaaaccaaaactagtcaggatcaggagccggaggaggagcagcagcagcagcagcaa
aatgtgatatcgaacggtgactgcaaggcaatgagtgatgatgatgtggctgcagcggag
gcggaagtggcagtggactccccgagcgagaaagcaagcgtaaatggctccaacgttgcc
aacaacagcagcaacactaataagaaaattgccgtcgcttctcatcccaccagcacccag
cccagtgatgatgatgatgatggaaatgcagatgcggatgacgtggacgaacaggccgcc
gaggagaatggtcacgatgctgaagtggatgaggcatcctgccgctctaacagtacctgc
agctcctcgaccgcctccagtcgtctgtccacgccaccgcccacaggcgaggatgacagc
acgccagtctcgccctcgaaaacccttcaggccaagctggtggcagccaatttgaatgcg
ctgcaacggcagacgtccaatcaggctcagacccaaaagcagcgttgcaagagttgcgac
cattcgcgcagtgggctgcaggttcggaagaccagctccctgcgcggagcgcaagaactc
gagttggatagtaaggctagaaatggaacgcacgctgctctctgcaaaagcacgcccgtg
atcaacaaccacagccatcatcataatcatagtcacagccacaaccacaaccaccatcat
catcatcaccatcactcgcatcacaatcacagtcagcacggaatcgggattggcagtgcc
agcatcggcggtagtgggctaatcagcctggccacaccactgctggctatggacagtgat
aggataccaaaaatcgtaggcaaaattggaaatctcgatggcctgcccttcgccaatggc
attggaggtccacaaaatggtcatgggttgcccttcggcagctatcagcatcatcatcat
caacagcatcatcatcatctactggcgcgtcggcattcggagacaaatagcaatggggcc
accgctatggcggttgaaaaataa

DBGET integrated database retrieval system