KEGG   Drosophila simulans: Dsimw501_GD23472Help
Entry
Dsimw501_GD23472  CDS       T01065                                 

Gene name
Dsim_GD23472
Definition
(RefSeq) GD23472 gene product from transcript GD23472-RB
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dsi  Drosophila simulans
Pathway
dsi00010  Glycolysis / Gluconeogenesis
dsi00020  Citrate cycle (TCA cycle)
dsi00620  Pyruvate metabolism
dsi01100  Metabolic pathways
dsi01200  Carbon metabolism
Module
dsi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD23472 (Dsim_GD23472)
   00020 Citrate cycle (TCA cycle)
    Dsimw501_GD23472 (Dsim_GD23472)
   00620 Pyruvate metabolism
    Dsimw501_GD23472 (Dsim_GD23472)
Enzymes [BR:dsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dsimw501_GD23472 (Dsim_GD23472)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl DUF3614 TraK Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 6731353
NCBI-ProteinID: XP_002078507
UniProt: B4Q5P6
Position
2L
AA seq 496 aa AA seqDB search
MLRSLATTRNELGALRSVLLRSNNATYVRRSTGNVVVRALSSQLINSRNLQSIRSKLNTS
QSPVTWSYNFARAYANLPEHIRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEIETD
KATMGFETPEEGFLAKILIQGGTKDVPVGQLLCIIVPDQGSVAAFANFKDDGAAAAPAAP
AAAPAPAPAPAAAAAPPPPPAAAPAAAAPPPAPAAAPAAAGTGRVYASPMAKRLAEAQQL
RLQGQKPAAKPAAAAPAKAPKAAGTRYEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQ
VDKLLKFRAKVNKKYEKQGARVSVNDFIIKAVAIASLRVPEANSAWMDTVIRKYDDVDVS
VAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKARDNKLQPHEFQGGTISVSNLGMFG
VNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNMLTVTLSADHRVVDGAVAARW
LQHFRDYMEDPSNMVL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacaacacgaaacgaacttggggcccttcgctccgtgctcctg
cgatcgaataacgccacctatgtccgccgatcgacgggaaatgtggtagtgcgcgccctc
agcagccagctgatcaactcccggaatctccagagcatcaggtcgaaactcaacactagc
cagtcgccggtcacatggagctacaacttcgcccgtgcctatgcaaaccttccggaacac
atcagggtgccactgcccgcgctttcacccactatggagcgcggatcgattgtcagctgg
gagaagaaggagggcgacaagctcaacgaaggtgacctgctgtgtgagattgagacggac
aaggccaccatgggcttcgagacgcccgaggagggctttctggctaagattctcatccag
ggcggcaccaaggacgttcccgtgggccagctgctgtgcattatcgtaccggaccaaggc
agcgtagctgccttcgcgaacttcaaggacgacggtgccgcagcagcaccagctgctccg
gcagcagctccagctccagctccagcacccgcagcagcagcagcaccgccaccaccaccc
gccgcagctccagctgccgctgcgcccccaccagctcccgctgctgctccagctgcagca
ggtacgggccgtgtgtatgccagtcccatggccaagcgactagccgaggcacaacagctg
cgtctacaaggccagaagccagcagccaagccagctgctgcggcacctgccaaggcaccc
aaggcagctggaacgcgctacgaggacatcccggtgaccaacatgcgcgcagtgattgcc
aaacgcctgctggagtcaaagacccaactgcctcactactacgtcactgtgcaatgccaa
gtggataagctcctgaagttccgcgcgaaggtgaacaagaagtacgagaagcagggtgcc
cgcgtctctgtgaacgacttcattatcaaggccgtggccatcgccagtcttagggttccc
gaagcgaactccgcctggatggacactgtaatccgcaagtacgacgacgtcgacgtttct
gttgctgtctccacagataagggtctgattaccccgattgtcttcaatgccgaccgcaag
ggagtcctggagatctccaaggatgtcaaggctctggcagccaaggcgcgcgacaacaaa
ctgcagccccacgaattccagggtggcaccatttcggtttctaatctgggcatgttcggt
gtgaaccagtttgccgctgttatcaaccctcctcaatcgtgcatccttgccattggtacc
acaacgaagcagttggttgctgatcccgacagtttgaagggcttcaaggaggtcaacatg
ctgacggtcaccctgagtgctgatcatcgtgttgtggatggtgctgttgctgccaggtgg
ctgcagcacttccgcgactacatggaggatccttccaatatggtattgtaa

DBGET integrated database retrieval system