KEGG   Drosophila simulans: Dsimw501_GD24908
Entry
Dsimw501_GD24908  CDS       T01065                                 

Symbol
Dsim_GD24908
Name
(GenBank) uncharacterized protein, isoform E
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
dsi  Drosophila simulans
Pathway
dsi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    Dsimw501_GD24908 (Dsim_GD24908)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dsimw501_GD24908 (Dsim_GD24908)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     Dsimw501_GD24908 (Dsim_GD24908)
SSDB
Motif
Pfam: NAD_binding_4 Sterile 3Beta_HSD Epimerase Polysacc_synt_2 GDP_Man_Dehyd Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: KMY96477
FlyBase: FBgn0196224
UniProt: A0A0J9RL31
Position
2R
AA seq 506 aa
MTVDLSPVQEYYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRL
EEMFKLPIFQRIKDERPEMLKRVTIYQGDVTFDQLGLSGESLKHVTENTNIVFHMAATLK
LEGNLRDAIDMNLLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQEVMYEKVYEFPHKPED
LMRLAEWMDVKTLDAITPDLLKPHPNTYTYSKRLAELLVRDHYESMPVIIARPSIVTPAV
AEPLPGWVDNMNGPTGVLIGAGKGVIRSMICNGELKSEVIPVDIAINGLILLPYHNSLAE
KRPLQIPVYNLTVDDAKKRTWKWIMDVGRDLGIKYPFEVGLWYPDGNMTSSKFYHTICTI
LFMWLPAYLIDFLLLIFGQRRFMIRVQTKIAVGLEVLQFFTTRSWDFKSTHFEQIYKELG
STDRRIFKINTDDVDDYEYMKVSILGGRQYVMKEPLTSLPKSRIQLRFMYVLDRICKTMI
ISGLLYWVSQKLRVVDLLRSAFPSST
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgacggtggatctatcgcctgtgcaggaatactataaggataagacgatcttcatcact
ggagcgtctgggttcatgggcaaagttctgctggagaagttgctctactcctgccactcc
ctcaaggaggtgatcatcatctgtcgcccgaagcgcggcaaggcaccggagacgcgtctc
gaggagatgttcaagctgcccatcttccagcgcatcaaggacgagcggccggagatgctc
aagagggttaccatctaccagggcgacgtcaccttcgaccagcttgggctcagcggggag
agcctcaagcacgtgaccgagaacactaacattgttttccacatggcggccacccttaag
ctggagggcaatcttcgagacgccatcgacatgaacttgctgggcacccggcgagcgctc
aacgtggccaaggaaatgaagcagcttgaggccttcatccacttgtccacggctttctgc
aactgcgaccaggaggtgatgtatgagaaggtttacgagttcccacacaagccggaggat
cttatgcgactggccgagtggatggacgtgaagaccctggacgccattacgccggatttg
ctaaagccgcaccccaacacctacacctactcaaagcgcctggcggagcttctggtgcgc
gaccactacgagtccatgcccgtcatcatcgcccgtcccagcatcgtaactccagctgtc
gctgagcccctgccaggttgggtggacaatatgaacggacctacgggagttctcattggc
gccggcaaaggagttatccgatccatgatctgcaacggggagctaaaatctgaagtcata
cctgtggacatcgccattaacggcctaatcttgttaccatatcataacagtctggcggag
aagagacctcttcagatcccagtctacaacttgaccgtggacgatgccaaaaagcgcaca
tggaaatggataatggatgtgggtcgcgacttgggcattaagtaccccttcgaagtggga
ctctggtatcccgacggcaacatgacgtccagcaaattctatcacaccatctgcaccatt
ctgtttatgtggctgccagcctaccttatcgacttcctactcctgatctttggacaacgt
cgcttcatgatacgggttcaaaccaaaatcgctgtgggtctggaagttttgcagttcttt
accacgcgaagctgggacttcaaatccacacactttgagcagatctacaaagaattagga
tctacagatcggaggatatttaagattaacaccgacgatgtcgacgattatgagtacatg
aaagtcagtattttgggtggccgtcagtatgtgatgaaggaacctttaacttcgttgccg
aaatcgcgcatacaattgagattcatgtatgtcctggaccgtatttgcaaaacaatgata
atttcaggccttctgtactgggtttcccaaaaactgagagtagtcgacctattgagaagc
gcattcccttctagtacataa

DBGET integrated database retrieval system