KEGG   Drosophila simulans: Dsimw501_GD25117Help
Entry
Dsimw501_GD25117  CDS       T01065                                 

Gene name
Dsim_GD25117
Definition
(RefSeq) GD25117 gene product from transcript GD25117-RB
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dsi  Drosophila simulans
Pathway
dsi00040  Pentose and glucuronate interconversions
dsi00053  Ascorbate and aldarate metabolism
dsi00830  Retinol metabolism
dsi00860  Porphyrin and chlorophyll metabolism
dsi00980  Metabolism of xenobiotics by cytochrome P450
dsi00982  Drug metabolism - cytochrome P450
dsi00983  Drug metabolism - other enzymes
dsi01100  Metabolic pathways
Module
dsi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dsimw501_GD25117 (Dsim_GD25117)
   00053 Ascorbate and aldarate metabolism
    Dsimw501_GD25117 (Dsim_GD25117)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dsimw501_GD25117 (Dsim_GD25117)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD25117 (Dsim_GD25117)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD25117 (Dsim_GD25117)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD25117 (Dsim_GD25117)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD25117 (Dsim_GD25117)
Enzymes [BR:dsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dsimw501_GD25117 (Dsim_GD25117)
Glycosyltransferases [BR:dsi01003]
 Others
  Hydrophobic molecule
   Dsimw501_GD25117 (Dsim_GD25117)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_transf_4 Myco_arth_vir_N Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 6735729
NCBI-ProteinID: XP_016029098
UniProt: A0A0J9RJ13
Position
2R
AA seq 529 aa AA seqDB search
MESQWNRWIVLAILGLALGQISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYT
GHGLGESLDNVTETVTAEFPFWSELQKQAAPKGNLADLGRLPIEKLRQSLASVGARALDH
FLAQEPIQRLLKMSYLEFDFDVILVDYFYTEALLALGALHQRPVVGIISTDFGNYMDAVQ
EALVPAACSPIDFERDQPEMGFSERLENIRTCIARRKQFIKDHYGGQEQLVAKYFQLQSS
IPELQASQLSVLLLNSHVPLITPKVSIQQIVPAGGLHIRGPKELPWNVKRFLEEARPGAI
YVQLGNEQACGQLPKEKLETLFAFFSSRKQSIIWTCHDVKTLEGLPKNVMIQHAVPQIDI
LAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEVRNMELAVRLGVGLQLEEGNVTT
ESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIG
ISSCQLHLFDLFVFYAGIATLVVTLLAALSFGGFYIWNKKNNSKSTKVN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcaatggaatcgttggatcgtgctggctattttgggactagctctgggccag
atttcacaggcagccaaaatcctggtactgtttccccatgtcaacgagggtcactttgcg
gtgatgcggactctggtcaccgagttggctaatcgggagcacactattgaagtatatacc
ggtcatggtttgggagaatctctggataatgttacagaaacggtcacagcggagtttccc
ttttggagcgaattgcaaaaacaggcggctcccaaaggaaaccttgctgatcttggtcgc
ctaccgattgaaaaactccgccagtcattggccagcgttggagcgcgcgctttggaccac
ttcctcgcccaagagcccatccaaaggctgctgaagatgtcctatcttgagttcgatttc
gatgtgatcctagtggactacttctacacagaggctttgttggcactgggagctctccat
cagcggccagttgtagggattatttctacggacttcggcaactacatggatgccgtacag
gaggcactggtaccagccgcttgttcacccatcgactttgagcgggatcaacccgaaatg
ggcttctccgagcgattggaaaatatccggacatgtattgctcgccgtaagcagttcatc
aaggatcactacggcggtcaggagcagttggtggccaagtacttccagctgcagagctct
attcccgagctgcaggccagccagctatccgtgctgctgctcaatagtcatgtgccattg
ataactcctaaagttagtatccaacagatagttcccgccggtggacttcacatccgtggt
cccaaggagctgccctggaatgtgaagcgcttcctggaggaggcgcgtcctggagccatc
tacgttcaactgggcaatgagcaggcttgtggccagctacccaaggagaaactcgagact
ctgtttgccttcttctcctccagaaagcagagcataatctggacctgtcacgacgtcaag
accctggagggactgccaaagaatgttatgatccagcatgcggtgccgcagatagacatc
ctggcccatccgagagtcaaggctttcctaaccaatggagacctcctcaacctgcaggag
ggcatcatgcggaatgtgcccattctgggattgcccctattccagcacgaagttcggaac
atggagctagccgtgcgattaggagtgggcctacagctggaggagggcaatgtgactact
gagtcactaaactgggcagtggacaggctactcctcgagtcacacttccagttgaccatc
cgggatgtgtccctggagttcagggaccgtcctcttggcgctctcgccagcgctctcttc
tgggtgaactacgtggcccggcacaagggaggatcggctctgaggacccgaggcattgga
atctcatcctgccagctgcacctgttcgacctcttcgtgttctatgccggaatagctact
ctagtcgtaaccttactggcggccctgagttttggcggcttttatatttggaataagaaa
aacaactccaagtcgaccaaagtaaattag

DBGET integrated database retrieval system