KEGG   Drosophila simulans: Dsimw501_GD25738Help
Entry
Dsimw501_GD25738  CDS       T01065                                 

Gene name
Dsim_GD25738
Definition
(RefSeq) GD25738 gene product from transcript GD25738-RA
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dsi  Drosophila simulans
Pathway
dsi00062  Fatty acid elongation
dsi00071  Fatty acid degradation
dsi00280  Valine, leucine and isoleucine degradation
dsi00310  Lysine degradation
dsi00380  Tryptophan metabolism
dsi00410  beta-Alanine metabolism
dsi00640  Propanoate metabolism
dsi00650  Butanoate metabolism
dsi01100  Metabolic pathways
dsi01200  Carbon metabolism
dsi01212  Fatty acid metabolism
Module
dsi_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dsi_M00085  Fatty acid biosynthesis, elongation, mitochondria
dsi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dsi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dsimw501_GD25738 (Dsim_GD25738)
   00650 Butanoate metabolism
    Dsimw501_GD25738 (Dsim_GD25738)
  Lipid metabolism
   00062 Fatty acid elongation
    Dsimw501_GD25738 (Dsim_GD25738)
   00071 Fatty acid degradation
    Dsimw501_GD25738 (Dsim_GD25738)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dsimw501_GD25738 (Dsim_GD25738)
   00310 Lysine degradation
    Dsimw501_GD25738 (Dsim_GD25738)
   00380 Tryptophan metabolism
    Dsimw501_GD25738 (Dsim_GD25738)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsimw501_GD25738 (Dsim_GD25738)
Enzymes [BR:dsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dsimw501_GD25738 (Dsim_GD25738)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 6734368
NCBI-ProteinID: XP_016027449
UniProt: A0A0J9RC54
Position
2R
AA seq 328 aa AA seqDB search
MAFLVGANAVTPAPLVRQYCSSASQPGSQFLHLKMANIAKIFASRAQGVLQAAARQPQVA
TRFSSSSTNNWEYIKTEVAGEGKNVAVITLNRPKALNALCNGLMKELSTALQQFGKDKTI
SAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGG
CELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQE
AEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRT
FHATFSTADRKEGMTAFAEKRPAKFTNE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctggtgggtgcgaacgcggtcacacctgccccactagtgcgccaatattgc
tccagtgcttcgcagcccggctcacagttccttcatttgaaaatggccaacattgctaag
atcttcgccagccgcgcccagggcgtcctgcaggcagccgcccgccagccacaggtggcc
acccgtttcagcagctcctccaccaacaactgggagtacatcaagaccgaagtggccggc
gagggcaagaacgtggccgttatcaccctgaaccgccccaaggctttgaatgccctctgc
aatggcctgatgaaggagctgtccaccgcgttgcagcaattcggcaaggataagaccatc
tccgccatcgttttgacgggcagtgagaaggccttcgccgctggcgctgatatcaaggag
atggtgggcaacacctactcgcagtgcatccagggcaacttcctgaacgactggacggag
gtggcccgcacccagaagcccatcattgctgccgtgaatggttacgccttgggcggtggc
tgtgagctggccatgatgtgcgacatcatctatgccggtgacaaggccaagtttggtcag
cctgagattgccctgggcaccattcccggagccggtggcacccagcgtctgacccgcgtc
gttggcaagtccaaggccatggagatgtgcctcaccggcaacatgatcggcgcccaggag
gccgagaagctgggtctggccagcaaggtggtgcccgccgaccagttgctgggcgaggcc
gtcaagctgggcgagaagatcggcacccactccaatctgattgtgcagctgtgcaaggag
gccgttaacacggcttacgagaccactctccaggagggtctgaagttcgagcgtcgcacc
ttccatgccacgttctccacggccgatcgcaaggagggcatgaccgccttcgccgagaag
cgccctgccaagtttaccaacgagtaa

DBGET integrated database retrieval system